Anti-Estrogen Related Receptor gamma antibody (ab171816)
Key features and details
- Mouse polyclonal to Estrogen Related Receptor gamma
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Estrogen Related Receptor gamma antibody
See all Estrogen Related Receptor gamma primary antibodies -
Description
Mouse polyclonal to Estrogen Related Receptor gamma -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Orangutan -
Immunogen
Full length protein corresponding to Human Estrogen Related Receptor gamma aa 1-435. Mature Estrogen Related Receptor gamma
Sequence:MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMN GHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSM PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEIT KRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLN PQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLAD RELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDE LVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIA LANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPL LRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Database link: NP_996317.1 -
Positive control
- Estrogen Related Receptor gamma-transfected 293T cell line lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab171816 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa. |
Target
-
Function
Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements. -
Tissue specificity
Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland. -
Sequence similarities
Belongs to the nuclear hormone receptor family. NR3 subfamily.
Contains 1 nuclear receptor DNA-binding domain. -
Developmental stage
Expressed at high levels in fetal brain and also in the fetal kidney, lung and liver. -
Post-translational
modificationsSumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.
Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 2104 Human
- Entrez Gene: 26381 Mouse
- Entrez Gene: 360896 Rat
- Omim: 602969 Human
- SwissProt: P62508 Human
- SwissProt: P62509 Mouse
- SwissProt: P62510 Rat
- Unigene: 444225 Human
see all -
Alternative names
- DKFZp781L1617 antibody
- ERR 3 antibody
- ERR G2 antibody
see all
Images
-
All lanes : Anti-Estrogen Related Receptor gamma antibody (ab171816) at 1 µg/ml
Lane 1 : Estrogen Related Receptor gamma-transfected 293T cell line lysate
Lane 2 : Non-transfected lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 49 kDa
Datasheets and documents
References (0)
ab171816 has not yet been referenced specifically in any publications.