For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    estrogen-related-receptor-gamma-antibody-ab171816.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Domain Families Zinc Finger
Share by email

Anti-Estrogen Related Receptor gamma antibody (ab171816)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Estrogen Related Receptor gamma antibody (ab171816)

    Key features and details

    • Mouse polyclonal to Estrogen Related Receptor gamma
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Recombinant Human Estrogen Related Receptor gamma protein (ab152371)
    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-Estrogen Related Receptor gamma antibody
      See all Estrogen Related Receptor gamma primary antibodies
    • Description

      Mouse polyclonal to Estrogen Related Receptor gamma
    • Host species

      Mouse
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat, Orangutan
    • Immunogen

      Full length protein corresponding to Human Estrogen Related Receptor gamma aa 1-435. Mature Estrogen Related Receptor gamma
      Sequence:

      MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMN GHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSM PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEIT KRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLN PQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLAD RELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDE LVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIA LANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPL LRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV


      Database link: NP_996317.1
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • Estrogen Related Receptor gamma-transfected 293T cell line lysate.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.4
      Constituent: 100% PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Epigenetics and Nuclear Signaling
      • Transcription
      • Domain Families
      • Zinc Finger
      • Signal Transduction
      • Signaling Pathway
      • Nuclear Signaling
      • Nuclear Hormone Receptors
      • Estrogen
      • Epigenetics and Nuclear Signaling
      • Nuclear Signaling Pathways
      • Nuclear Receptors
      • Estrogen
      • Cancer
      • Signal transduction
      • Nuclear signaling
      • Nuclear hormone receptors
      • Estrogen

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG - Isotype Control (ab37355)
    • Recombinant Protein

      • Recombinant Human Estrogen Related Receptor gamma protein (ab152371)
    • Related Products

      • Recombinant Human Estrogen Related Receptor gamma protein (ab152371)

    Applications

    Our Abpromise guarantee covers the use of ab171816 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.

    Target

    • Function

      Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.
    • Tissue specificity

      Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland.
    • Sequence similarities

      Belongs to the nuclear hormone receptor family. NR3 subfamily.
      Contains 1 nuclear receptor DNA-binding domain.
    • Developmental stage

      Expressed at high levels in fetal brain and also in the fetal kidney, lung and liver.
    • Post-translational
      modifications

      Sumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.
      Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity.
    • Cellular localization

      Nucleus.
    • Target information above from: UniProt accession P62508 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 2104 Human
      • Entrez Gene: 26381 Mouse
      • Entrez Gene: 360896 Rat
      • Omim: 602969 Human
      • SwissProt: P62508 Human
      • SwissProt: P62509 Mouse
      • SwissProt: P62510 Rat
      • Unigene: 444225 Human
      • Unigene: 388156 Mouse
      • Unigene: 89989 Mouse
      • Unigene: 214491 Rat
      see all
    • Alternative names

      • DKFZp781L1617 antibody
      • ERR 3 antibody
      • ERR G2 antibody
      • ERR gamma 2 antibody
      • ERR gamma-2 antibody
      • ERR3 antibody
      • ERR3_HUMAN antibody
      • ERRG 2 antibody
      • ERRG2 antibody
      • ERRgamma antibody
      • ESRRG antibody
      • Estrogen receptor related protein 3 antibody
      • Estrogen receptor-related protein 3 antibody
      • Estrogen-related receptor gamma antibody
      • FLJ16023 antibody
      • KIAA0832 antibody
      • NR3B3 antibody
      • Nuclear receptor subfamily 3 group B member 3 antibody
      see all

    Images

    • Western blot - Anti-Estrogen Related Receptor gamma antibody (ab171816)
      Western blot - Anti-Estrogen Related Receptor gamma antibody (ab171816)
      All lanes : Anti-Estrogen Related Receptor gamma antibody (ab171816) at 1 µg/ml

      Lane 1 : Estrogen Related Receptor gamma-transfected 293T cell line lysate
      Lane 2 : Non-transfected lysate

      Lysates/proteins at 15 µl per lane.

      Secondary
      All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

      Developed using the ECL technique.

      Predicted band size: 49 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab171816? Please let us know so that we can cite the reference in this datasheet.

    ab171816 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab171816.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.