Overview

  • Product name
    Anti-Estrogen Related Receptor gamma antibody
    See all Estrogen Related Receptor gamma primary antibodies
  • Description
    Mouse polyclonal to Estrogen Related Receptor gamma
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Full length protein corresponding to Human Estrogen Related Receptor gamma aa 1-435. Mature Estrogen Related Receptor gamma
    Sequence:

    MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMN GHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSM PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEIT KRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLN PQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLAD RELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDE LVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIA LANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPL LRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV


    Database link: NP_996317.1

  • Positive control
    • Estrogen Related Receptor gamma-transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab171816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.

Target

  • Function
    Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.
  • Tissue specificity
    Expressed in the heart, kidney, brain, lung, bone marrow, adrenal gland, trachea, spinal cord and thyroid gland.
  • Sequence similarities
    Belongs to the nuclear hormone receptor family. NR3 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Developmental stage
    Expressed at high levels in fetal brain and also in the fetal kidney, lung and liver.
  • Post-translational
    modifications
    Sumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.
    Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp781L1617 antibody
    • ERR 3 antibody
    • ERR G2 antibody
    • ERR gamma 2 antibody
    • ERR gamma-2 antibody
    • ERR3 antibody
    • ERR3_HUMAN antibody
    • ERRG 2 antibody
    • ERRG2 antibody
    • ERRgamma antibody
    • ESRRG antibody
    • Estrogen receptor related protein 3 antibody
    • Estrogen receptor-related protein 3 antibody
    • Estrogen-related receptor gamma antibody
    • FLJ16023 antibody
    • KIAA0832 antibody
    • NR3B3 antibody
    • Nuclear receptor subfamily 3 group B member 3 antibody
    see all

Images

  • All lanes : Anti-Estrogen Related Receptor gamma antibody (ab171816) at 1 µg/ml

    Lane 1 : Estrogen Related Receptor gamma-transfected 293T cell line lysate
    Lane 2 : Non-transfected lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 49 kDa

References

ab171816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up