Overview

  • Product name

    Anti-Estrogen Sulfotransferase antibody
    See all Estrogen Sulfotransferase primary antibodies
  • Description

    Rabbit polyclonal to Estrogen Sulfotransferase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Estrogen Sulfotransferase aa 175-246.
    Sequence:

    VKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIH HTSFQEMKNNPSTNYTTLPDEI


    Database link: P49888

  • Positive control

    • WB: RT4 cell lysate. IHC-P: Human duodenum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224761 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 35 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May control the level of the estrogen receptor by sulfurylating free estradiol. Maximally sulfates beta-estradiol and estrone at concentrations of 20 nM. Also sulfates dehydroepiandrosterone, pregnenolone, ethinylestradiol, equalenin, diethylstilbesterol and 1-naphthol, at significantly higher concentrations; however, cortisol, testosterone and dopamine are not sulfated.
  • Tissue specificity

    Liver, intestine and at lower level in the kidney.
  • Sequence similarities

    Belongs to the sulfotransferase 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EST antibody
    • EST-1 antibody
    • EST1 antibody
    • Estrogen sulfotransferase antibody
    • estrogen-preferring antibody
    • estrone sulfotransferase antibody
    • ST1E1 antibody
    • ST1E1_HUMAN antibody
    • STE antibody
    • Sulfotransferase 1E1 antibody
    • Sulfotransferase antibody
    • Sulfotransferase estrogen preferring antibody
    • Sulfotransferase family 1E member 1 antibody
    • SULT1E1 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for Estrogen Sulfotransferase using ab224761 at 1/50 dilution in immunohistochemical analysis.

  • Anti-Estrogen Sulfotransferase antibody (ab224761) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 35 kDa

References

ab224761 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Tissue lysate - whole (liver)
Gel Running Conditions
Reduced Denaturing (4-12% gel (bio rad))
Loading amount
10 µg
Specification
liver
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Mr. Jean Personnaz

Verified customer

Submitted Apr 18 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up