Overview

  • Product name

  • Description

    Rabbit polyclonal to ETFB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human ETFB aa 2-255. (Expressed in E.coli).
    Sequence:

    AELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVR LKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGP LQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFAS QVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKA KKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKE IGRI


    Database link: P38117

  • Positive control

    • IHC-P: Human liver, breast cancer, prostate cancer, liver cancer, prostate and colorectal cancer tissues. WB: Pig liver, heart and skeletal muscle tissue lysates; Recombinant human ETFB protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).
  • Tissue specificity

    Abundant in liver, heart and skeletal muscle. A weak expression is seen in the brain, placenta, lung, kidney and pancreas.
  • Involvement in disease

    Glutaric aciduria 2B
  • Sequence similarities

    Belongs to the ETF beta-subunit/FixA family.
  • Domain

    The recognition loop recognizes a hydrophobic patch at the surface of interacting dehydrogenases and acts as a static anchor at the interface.
  • Post-translational
    modifications

    Methylated. Trimethylation at Lys-200 and Lys-203 may negatively regulate the activity in electron transfer from Acyl-CoA dehydrogenases.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta ETF antibody
    • Beta-ETF antibody
    • Electron transfer flavoprotein beta polypeptide antibody
    • Electron transfer flavoprotein beta subunit antibody
    • Electron transfer flavoprotein subunit beta antibody
    • Electron transferring flavoprotein beta polypeptide antibody
    • etfB antibody
    • ETFB_HUMAN antibody
    • FP585 antibody
    • MADD antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for ETFB using ab232815 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for ETFB using ab232815 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for ETFB using ab232815 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver cancer tissue stained for ETFB using ab232815 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for ETFB using ab232815 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human colorectal cancer tissue stained for ETFB using ab232815 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-ETFB antibody (ab232815) at 3 µg/ml + Recombinant human ETFB protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

  • All lanes : Anti-ETFB antibody (ab232815) at 3 µg/ml

    Lane 1 : Pig liver lysate
    Lane 2 : Pig heart lysate
    Lane 3 : Pig skeletal muscle lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

References

ab232815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up