Anti-ETFDH antibody - C-terminal (ab224663)
Key features and details
- Rabbit polyclonal to ETFDH - C-terminal
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-ETFDH antibody - C-terminal
See all ETFDH primary antibodies -
Description
Rabbit polyclonal to ETFDH - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human ETFDH aa 318-617 (C terminal).
Sequence:LVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIAYGARALN EGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQ LTSENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGG MIYTGIFYWILRGMEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFD LLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRFCPAGVYE FVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM
Database link: Q16134 -
Positive control
- WB: Mouse liver and kidney tissue lysates; HEK-293T whole cell lysate. IHC-P: Human kidney and small intestine tissues. ICC/IF: PC-3 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224663 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Detects a band of approximately 68 kDa (predicted molecular weight: 63,69 kDa). | |
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Accepts electrons from ETF and reduces ubiquinone. -
Involvement in disease
Defects in ETFDH are the cause of glutaric aciduria type 2C (GA2C) [MIM:231680]. GA2C is an autosomal recessively inherited disorder of fatty acid, amino acid, and choline metabolism. It is characterized by multiple acyl-CoA dehydrogenase deficiencies resulting in large excretion not only of glutaric acid, but also of lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. -
Sequence similarities
Belongs to the ETF-QO/fixC family.
Contains 1 4Fe-4S ferredoxin-type domain. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 2110 Human
- Entrez Gene: 66841 Mouse
- Omim: 231675 Human
- SwissProt: Q16134 Human
- SwissProt: Q921G7 Mouse
- Unigene: 155729 Human
- Unigene: 28336 Mouse
-
Alternative names
- Electron transfer flavoprotein ubiquinone oxidoreductase antibody
- Electron transfer flavoprotein-ubiquinone oxidoreductase antibody
- electron transferring flavoprotein dehydrogenase antibody
see all
Images
-
All lanes : Anti-ETFDH antibody - C-terminal (ab224663) at 1/500 dilution
Lane 1 : Mouse liver tissue lysate
Lane 2 : Mouse kidney tissue lysate
Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 63,69 kDa
Observed band size: 68 kDa why is the actual band size different from the predicted? -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ETFDH antibody - C-terminal (ab224663)
Paraffin-embedded human kidney tissue stained for ETFDH using ab224663 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ETFDH antibody - C-terminal (ab224663)
Paraffin-embedded human small intestine tissue stained for ETFDH using ab224663 at 1/100 dilution in immunohistochemical analysis.
-
PC-3 (human prostate adenocarcinoma cell line) cells stained for ETFDH (green) using ab224663 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab224663 has not yet been referenced specifically in any publications.