Anti-ethanolamine kinase antibody (ab236615)
Key features and details
- Rabbit polyclonal to ethanolamine kinase
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ethanolamine kinase antibody -
Description
Rabbit polyclonal to ethanolamine kinase -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human ethanolamine kinase aa 90-258.
Sequence:MANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVT LQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVL QAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKT TRCFGLTGCRGSRLLLSFF
Database link: Q9HBU6-2 -
Positive control
- WB: A549, A431, HepG2 and MCF7 whole cell lysate. ICC/IF: A549 cells. IHC-P: Human thyroid tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab236615 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/2000. | |
| IHC-P | 1/20 - 1/200. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Highly specific for ethanolamine phosphorylation. May be a rate-controlling step in phosphatidylethanolamine biosynthesis. -
Tissue specificity
Expressed in kidney, liver, placenta, heart, leukocyte, ovary and testis. -
Pathway
Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 1/3. -
Sequence similarities
Belongs to the choline/ethanolamine kinase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 55500 Human
- Omim: 609858 Human
- SwissProt: Q9HBU6 Human
- Unigene: 29464 Human
-
Alternative names
- 1110061E11Rik antibody
- 4930555L11Rik antibody
- AI195356 antibody
see all
Images
-
Western blot - Anti-ethanolamine kinase antibody (ab236615)All lanes : Anti-ethanolamine kinase antibody (ab236615) at 1/500 dilution
Lane 1 : A549 (Human lung carcinoma cell line) whole cell lysate
Lane 2 : A431 (Human epidermoid carcinoma cell line) whole cell lysate
Lane 3 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 4 : MCF7 (Human breast adenocarcinoma cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ethanolamine kinase antibody (ab236615)Paraffin-embedded human thyroid tissue stained for ethanolamine kinase with ab236615 at a 1/100 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-ethanolamine kinase antibody (ab236615)A549 (Human lung carcinoma cell line) cells stained for ethanolamine kinase (Green) using ab236615 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236615 has not yet been referenced specifically in any publications.
