Overview

  • Product name

    Anti-ethanolamine kinase antibody
  • Description

    Rabbit polyclonal to ethanolamine kinase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ethanolamine kinase aa 90-258.
    Sequence:

    MANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVT LQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVL QAHGCAPQLYCTFNNGLCYEFIQGEALDPKHVCNPAIFSLSSLTLCKGKT TRCFGLTGCRGSRLLLSFF


    Database link: Q9HBU6-2

  • Positive control

    • WB: A549, A431, HepG2 and MCF7 whole cell lysate. ICC/IF: A549 cells. IHC-P: Human thyroid tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Highly specific for ethanolamine phosphorylation. May be a rate-controlling step in phosphatidylethanolamine biosynthesis.
  • Tissue specificity

    Expressed in kidney, liver, placenta, heart, leukocyte, ovary and testis.
  • Pathway

    Phospholipid metabolism; phosphatidylethanolamine biosynthesis; phosphatidylethanolamine from ethanolamine: step 1/3.
  • Sequence similarities

    Belongs to the choline/ethanolamine kinase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110061E11Rik antibody
    • 4930555L11Rik antibody
    • AI195356 antibody
    • AI841245 antibody
    • C80956 antibody
    • D6Ertd3e antibody
    • EKI 1 antibody
    • EKI antibody
    • EKI1 antibody
    • EKI1_HUMAN antibody
    • Ethanolamine kinase 1 antibody
    • ETNK1 antibody
    • Nbla10396 antibody
    • Putative protein product of Nbla10396 antibody
    see all

Images

  • All lanes : Anti-ethanolamine kinase antibody (ab236615) at 1/500 dilution

    Lane 1 : A549 (Human lung carcinoma cell line) whole cell lysate
    Lane 2 : A431 (Human epidermoid carcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : MCF7 (Human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human thyroid tissue stained for ethanolamine kinase with ab236615 at a 1/100 dilution in immunohistochemical analysis.

  • A549 (Human lung carcinoma cell line) cells stained for ethanolamine kinase (Green) using ab236615 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236615 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up