Overview

  • Product name

  • Description

    Rabbit polyclonal to ETL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human ETL aa 335-385 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VISVSMSSNPPTLYELEKITFTLSHRKVTDRYRSLCAFWNYSPDTMNGSW S


    Database link: Q9HBW9

  • Positive control

    • Mouse kidney lysates and rat uterus tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

When using a fluorescent probe the recommended dilution is 1/50 – 1/500.

Flow Cyt 1/100.

Target

  • Function

    Could be involved in cardiac development.
  • Tissue specificity

    Mainly expressed in smooth muscle.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 2 EGF-like domains.
    Contains 1 GPS domain.
  • Developmental stage

    Up-regulated in the adult heart.
  • Domain

    The transmembrane domain is not required for cleavage, but it is required for dimer formation.
  • Post-translational
    modifications

    Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADGRL4 antibody
    • Adhesion G protein-coupled receptor L4 antibody
    • EGF antibody
    • EGF latrophilin and seven transmembrane domain containing 1 antibody
    • EGF TM7 latrophilin related protein antibody
    • EGF, latrophilin and seven transmembrane domain-containing protein 1 antibody
    • EGF, latrophilin, and 7 transmembrane domain-containing protein 1 antibody
    • EGF-, TM7-, and latrophilin-related protein antibody
    • EGF-TM7-latrophilin-related protein antibody
    • EGFTM7 latrophilin related protein antibody
    • ELTD 1 antibody
    • ELTD1 antibody
    • ELTD1_HUMAN antibody
    • ETL antibody
    • ETL protein antibody
    • KPG_003 antibody
    • latrophilin and seven transmembrane domain-containing protein 1 antibody
    • UNQ202/PRO228 antibody
    • zgc:63629 antibody
    see all

Images

  • Flow cytometry analysis of mouse kidney lysates labeling ETL (green), using ab217175 at a 1/100 dilution, and unstained cells cells (blue). FITC-conjugated secondary antibodies were used for the analysis.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat uterus tissue, labeling ETL using ab217175 at a 1/500 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat uterus tissue, labeling ETL using ab217175 at a 1/500 dilution, followed by a secondary goat anti-rabbit IgG antibody conjugated to Cy3 at a 1/200 dilution and DAPI staining.

References

ab217175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up