Overview

  • Product name

    Anti-ETL antibody [CL4164]
    See all ETL primary antibodies
  • Description

    Mouse monoclonal [CL4164] to ETL
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ETL aa 71-181.
    Sequence:

    ENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNV CIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESS SLLGYKNNTIS


    Database link: Q9HBW9

  • Epitope

    Binds to an epitope located within the peptide sequence CVPGFRSSSN (aa 86-95) as determined by overlapping synthetic peptides.
  • Positive control

    • Human placenta, fallopian tube, stomach, cerebellum and liver tissues; Human placenta tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    CL4164
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 78 kDa.

Target

  • Function

    Could be involved in cardiac development.
  • Tissue specificity

    Mainly expressed in smooth muscle.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 2 EGF-like domains.
    Contains 1 GPS domain.
  • Developmental stage

    Up-regulated in the adult heart.
  • Domain

    The transmembrane domain is not required for cleavage, but it is required for dimer formation.
  • Post-translational
    modifications

    Proteolytically cleaved into 2 subunits, an extracellular alpha subunit and a seven-transmembrane subunit.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADGRL4 antibody
    • Adhesion G protein-coupled receptor L4 antibody
    • EGF antibody
    • EGF latrophilin and seven transmembrane domain containing 1 antibody
    • EGF TM7 latrophilin related protein antibody
    • EGF, latrophilin and seven transmembrane domain-containing protein 1 antibody
    • EGF, latrophilin, and 7 transmembrane domain-containing protein 1 antibody
    • EGF-, TM7-, and latrophilin-related protein antibody
    • EGF-TM7-latrophilin-related protein antibody
    • EGFTM7 latrophilin related protein antibody
    • ELTD 1 antibody
    • ELTD1 antibody
    • ELTD1_HUMAN antibody
    • ETL antibody
    • ETL protein antibody
    • KPG_003 antibody
    • latrophilin and seven transmembrane domain-containing protein 1 antibody
    • UNQ202/PRO228 antibody
    • zgc:63629 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human liver tissue labeling ETL with ab219974 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human cerebellum tissue labeling ETL with ab219974 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human stomach tissue labeling ETL with ab219974 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human fallopian tube tissue labeling ETL with ab219974 at 1/500 dilution.

  • Immunohistochemical analysis of paraffin-embedded human placenta tissue labeling ETL with ab219974 at 1/500 dilution.

  • Anti-ETL antibody [CL4164] (ab219974) at 1/500 dilution + Human placenta tissue lysate

    Predicted band size: 78 kDa

References

ab219974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up