Anti-ETV3 antibody (ab176717)
Key features and details
- Rabbit polyclonal to ETV3
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ETV3 antibody
See all ETV3 primary antibodies -
Description
Rabbit polyclonal to ETV3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Horse, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan -
Immunogen
Synthetic peptide within Human ETV3 aa 450-500. The exact sequence is proprietary. (NP_001138784.1).
Sequence:DSEDRPGKEPSAPEKKEDALMPPKLRLKRRWNDDPEARELSKSGKFLWNG S
Database link: P41162 -
Positive control
- Jurkat, HeLa and 293T whole cell lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176717 was affinity purified using an epitope specific to ETV3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab176717 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/10000. Predicted molecular weight: 57 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Transcriptional repressor that contribute to growth arrest during terminal macrophage differentiation by repressing target genes involved in Ras-dependent proliferation. Represses MMP1 promoter activity. -
Sequence similarities
Belongs to the ETS family.
Contains 1 ETS DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 457412 Chimpanzee
- Entrez Gene: 101129723 Gorilla
- Entrez Gene: 100064714 Horse
- Entrez Gene: 2117 Human
- Entrez Gene: 100449446 Orangutan
- Omim: 164873 Human
- SwissProt: A2T762 Chimpanzee
- SwissProt: A1YF15 Gorilla
see all -
Alternative names
- AI414410 antibody
- bA110J1.4 antibody
- ETS domain transcriptional repressor PE1 antibody
see all
Images
-
All lanes : Anti-ETV3 antibody (ab176717) at 0.1 µg/ml
Lane 1 : Jurkat whole cell lysate at 50 µg
Lane 2 : Jurkat whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa
Exposure time: 3 minutes -
Detection of ETV3 in immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176717 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 30 seconds.
Protocols
Datasheets and documents
References (0)
ab176717 has not yet been referenced specifically in any publications.