Anti-ETV3 antibody (ab176717)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ETV3 antibody
See all ETV3 primary antibodies -
Description
Rabbit polyclonal to ETV3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Horse, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
-
Immunogen
Synthetic peptide within Human ETV3 aa 450-500. The exact sequence is proprietary. (NP_001138784.1).
Sequence:DSEDRPGKEPSAPEKKEDALMPPKLRLKRRWNDDPEARELSKSGKFLWNG S
Database link: P41162 -
Positive control
- Jurkat, HeLa and 293T whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176717 was affinity purified using an epitope specific to ETV3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab176717 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/2000 - 1/10000. Predicted molecular weight: 57 kDa. | |
| IP | Use at 2-10 µg/mg of lysate. |
Target
-
Function
Transcriptional repressor that contribute to growth arrest during terminal macrophage differentiation by repressing target genes involved in Ras-dependent proliferation. Represses MMP1 promoter activity. -
Sequence similarities
Belongs to the ETS family.
Contains 1 ETS DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 457412 Chimpanzee
- Entrez Gene: 101129723 Gorilla
- Entrez Gene: 100064714 Horse
- Entrez Gene: 2117 Human
- Entrez Gene: 100449446 Orangutan
- Omim: 164873 Human
- SwissProt: A2T762 Chimpanzee
- SwissProt: A1YF15 Gorilla
see all -
Alternative names
- AI414410 antibody
- bA110J1.4 antibody
- ETS domain transcriptional repressor PE1 antibody
see all
Images
-
Western blot - Anti-ETV3 antibody (ab176717)All lanes : Anti-ETV3 antibody (ab176717) at 0.1 µg/ml
Lane 1 : Jurkat whole cell lysate at 50 µg
Lane 2 : Jurkat whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 57 kDa
Exposure time: 3 minutes -
Immunoprecipitation - Anti-ETV3 antibody (ab176717)Detection of ETV3 in immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176717 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 30 seconds.
Datasheets and documents
References
ab176717 has not yet been referenced specifically in any publications.
