Overview

  • Product name
  • Description
    Rabbit polyclonal to ETV3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human ETV3 aa 450-500. The exact sequence is proprietary. (NP_001138784.1).
    Sequence:

    DSEDRPGKEPSAPEKKEDALMPPKLRLKRRWNDDPEARELSKSGKFLWNG S


    Database link: P41162

  • Positive control
    • Jurkat, HeLa and 293T whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 57 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    Transcriptional repressor that contribute to growth arrest during terminal macrophage differentiation by repressing target genes involved in Ras-dependent proliferation. Represses MMP1 promoter activity.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • AI414410 antibody
    • bA110J1.4 antibody
    • ETS domain transcriptional repressor PE1 antibody
    • ETS family transcriptional repressor antibody
    • ETS translocation variant 3 antibody
    • ets variant 3 antibody
    • ets variant gene 3 antibody
    • ets variant gene 3, ETS family transcriptional repressor antibody
    • ETV3 antibody
    • ETV3_HUMAN antibody
    • ME PE1 antibody
    • METS antibody
    • Mitogenic Ets transcriptional suppressor antibody
    • Oncogene PE1 antibody
    • PE 1 antibody
    • PE-1 antibody
    • PE1 antibody
    see all

Images

  • All lanes : Anti-ETV3 antibody (ab176717) at 0.1 µg/ml

    Lane 1 : Jurkat whole cell lysate at 50 µg
    Lane 2 : Jurkat whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 57 kDa


    Exposure time: 3 minutes
  • Detection of ETV3 in immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176717 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab176717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up