Name: Anti-ETV3 antibody
SKU: ab176717

Product name

Anti-ETV3 antibody
See all ETV3 primary antibodies
Description

Rabbit polyclonal to ETV3
Host species

Rabbit
Tested applications

Suitable for: WB, IPmore details
Species reactivity

Reacts with: Human
Predicted to work with: Horse, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
Immunogen

Synthetic peptide within Human ETV3 aa 450-500. The exact sequence is proprietary. (NP_001138784.1).
Sequence:
DSEDRPGKEPSAPEKKEDALMPPKLRLKRRWNDDPEARELSKSGKFLWNG S

Database link: P41162

Run BLAST with Run BLAST with
Positive control
- Jurkat, HeLa and 293T whole cell lysates.

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Storage buffer

Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate

pH 7 to 8
Concentration information loading...
Purity

Immunogen affinity purified
Purification notes

ab176717 was affinity purified using an epitope specific to ETV3 immobilized on solid support.
Clonality

Polyclonal
Isotype

IgG
Research areas

Our Abpromise guarantee covers the use of ab176717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application	Abreviews	Notes
WB		1/2000 - 1/10000. Predicted molecular weight: 57 kDa.
IP		Use at 2-10 µg/mg of lysate.

Function

Transcriptional repressor that contribute to growth arrest during terminal macrophage differentiation by repressing target genes involved in Ras-dependent proliferation. Represses MMP1 promoter activity.
Sequence similarities

Belongs to the ETS family.
Contains 1 ETS DNA-binding domain.
Cellular localization

Nucleus.
Target information above from: UniProt accession P41162 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
Database links
- Entrez Gene: 457412 Chimpanzee
- Entrez Gene: 101129723 Gorilla
- Entrez Gene: 100064714 Horse
- Entrez Gene: 2117 Human
- Entrez Gene: 100449446 Orangutan
- Omim: 164873 Human
- SwissProt: A2T762 Chimpanzee
- SwissProt: A1YF15 Gorilla
- SwissProt: P41162 Human
- Unigene: 105636 Human
see all
Alternative names
- AI414410 antibody
- bA110J1.4 antibody
- ETS domain transcriptional repressor PE1 antibody
- ETS family transcriptional repressor antibody
- ETS translocation variant 3 antibody
- ets variant 3 antibody
- ets variant gene 3 antibody
- ets variant gene 3, ETS family transcriptional repressor antibody
- ETV3 antibody
- ETV3_HUMAN antibody
- ME PE1 antibody
- METS antibody
- Mitogenic Ets transcriptional suppressor antibody
- Oncogene PE1 antibody
- PE 1 antibody
- PE-1 antibody
- PE1 antibody
see all

Western blot - Anti-ETV3 antibody (ab176717)

All lanes : Anti-ETV3 antibody (ab176717) at 0.1 µg/ml

Lane 1 : Jurkat whole cell lysate at 50 µg
Lane 2 : Jurkat whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : 293T whole cell lysate at 50 µg

Developed using the ECL technique.

Predicted band size: 57 kDa

Exposure time: 3 minutes
Immunoprecipitation - Anti-ETV3 antibody (ab176717)

Detection of ETV3 in immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176717 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 30 seconds.

ab176717 has not yet been referenced specifically in any publications.

Publishing research using ab176717? Please let us know so that we can cite the reference in this datasheet.

Anti-ETV3 antibody (ab176717)

Customer reviews and Q&As