Overview

  • Product name

  • Description

    Rabbit polyclonal to ETV6 / Tel
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human ETV6/ Tel aa 90-210.
    Sequence:

    NGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNS IHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTN HRPSPDPEQRPLRSPLDNMIR


    Database link: P41212

  • Positive control

    • WB: U-2 OS and CACO-2 cell lysate. IHC-P: Human breast and skin tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 53 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Note=A chromosomal aberration involving ETV6 is found in a form of chronic myelomonocytic leukemia (CMML). Translocation t(5;12)(q33;p13) with PDGFRB. It is characterized by abnormal clonal myeloid proliferation and by progression to acute myelogenous leukemia (AML).
    Note=Chromosomal aberrations involving ETV6 are found in a form of acute myeloid leukemia (AML). Translocation t(12;22)(p13;q11) with MN1; translocation t(4;12)(q12;p13) with CHIC2.
    Note=Chromosomal aberrations involving ETV6 are found in childhood acute lymphoblastic leukemia (ALL). Translocations t(12;21)(p12;q22) and t(12;21)(p13;q22) with RUNX1/AML1.
    Note=A chromosomal aberration involving ETV6 is found in a form of pre-B acute myeloid leukemia. Translocation t(9;12)(p24;p13) with JAK2.
    Note=A chromosomal aberration involving ETV6 is found in myelodysplastic syndrome (MDS) with basophilia. Translocation t(5;12)(q31;p13) with ACSL6.
    Note=A chromosomal aberration involving ETV6 is found in acute eosinophilic leukemia (AEL). Translocation t(5;12)(q31;p13) with ACSL6.
    Note=A chromosomal aberration involving ETV6 is found in myelodysplastic syndrome (MDS). Translocation t(1;12)(p36.1;p13) with MDS2.
    Defects in ETV6 are a cause of myeloproliferative disorder chronic with eosinophilia (MPE) [MIM:131440]. A hematologic disorder characterized by malignant eosinophils proliferation. Note=A chromosomal aberration involving ETV6 is found in many instances of myeloproliferative disorder chronic with eosinophilia. Translocation t(5;12) with PDGFRB on chromosome 5 creating an ETV6-PDGFRB fusion protein.
    Defects in ETV6 are a cause of acute myelogenous leukemia (AML) [MIM:601626]. AML is a malignant disease in which hematopoietic precursors are arrested in an early stage of development.
    Note=A chromosomal aberration involving ETV6 is found in acute lymphoblastic leukemia. Translocation t(9;12)(p13;p13) with PAX5.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Post-translational
    modifications

    Phosphorylation of Ser-257 by MAPK14 (p38) inhibits ETV6 transcriptional repression.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ETS related protein Tel1 antibody
    • ETS translocation variant 6 antibody
    • Ets variant 6 antibody
    • Ets variant gene 6 (TEL oncogene) antibody
    • ETS-related protein Tel1 antibody
    • ETV 6 antibody
    • ETV6 antibody
    • ETV6_HUMAN antibody
    • Tel antibody
    • TEL oncogene antibody
    • TEL/ABL antibody
    • TEL1 antibody
    • TEL1 oncogene antibody
    • Transcription factor ETV 6 antibody
    • Transcription factor ETV6 antibody
    see all

Images

  • All lanes : Anti-ETV6 / Tel antibody (ab223705) at 0.4 µg/ml

    Lane 1 : U-2-OS cell lysate
    Lane 2 : CACO-2 cell lysate

    Predicted band size: 53 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for ETV6 / Tel (green) using ab223705 at 4 µg/ml in ICC/IF.

  • Immunohistochemical analysis of human breast tissue labeling ETV6 / Tel with ab223705 at 1/200 dilution.

  • Immunohistochemical analysis of human liver tissue labeling ETV6 / Tel with ab223705 at 1/200 dilution. No staining is observed.

  • Immunohistochemical analysis of human kidney tissue labeling ETV6 / Tel with ab223705 at 1/200 dilution. No staining is observed.

References

ab223705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up