Overview

  • Product name

  • Description

    Rabbit polyclonal to EURL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human EURL aa 182-231 (internal sequence).
    Sequence:

    LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE

  • Positive control

    • Fetal lung lysate
  • General notes

    Previously labelled as C21orf91.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab80695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1/12500.

WB Use a concentration of 1 µg/ml. Detects a band of approximately 38 kDa (predicted molecular weight: 34 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    EURL belongs to the EURL family. There are three named isoforms. The exact function of EURL remains unknown.
  • Database links

  • Alternative names

    • C21orf14 antibody
    • C21orf38 antibody
    • C21orf7 antibody
    • C21orf91 antibody
    • Chromosome 21 open reading frame 38 antibody
    • Chromosome 21 open reading frame 91 antibody
    • Early undifferentiated retina and lens antibody
    • EURL antibody
    • Protein EURL homolog antibody
    • YG81 antibody
    see all

Images

  • Anti-EURL antibody (ab80695) at 1 µg/ml + fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG

    Predicted band size: 34 kDa
    Observed band size: 38 kDa
    why is the actual band size different from the predicted?



    Gel concentration 12%

References

ab80695 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up