Overview

  • Product name

    Anti-EVI5 antibody - C-terminal
  • Description

    Rabbit polyclonal to EVI5 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EVI5 aa 719-810 (C terminal).
    Sequence:

    QPPFDGIHIVNHLIGDDESFHSSDEDFIDNSLQETGVGFPLHGKSGSMSL DPAVADGSESETEDSVLETRESNQVVQKERPPRRRESYSTTV


    Database link: O60447

  • Positive control

    • ICC/IF: U-251 MG (human brain glioma cell line) cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    EVI5 is a novel centrosomal protein with a complex expression pattern and subcellular localization, possibly involved in centrosome stability and dynamics. It may act as an oncogene.
  • Cellular localization

    Nucleus, centrosome.
  • Database links

  • Alternative names

    • ecotropic viral integration site 5 antibody
    • NB4S antibody
    • Neuroblastoma stage 4S gene antibody

Images

  • PFA fixed/ Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for EVI5 (green) using ab222387 at 4 µg/ml in ICC/IF.

References

ab222387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up