Overview

  • Product name

    Anti-EVL antibody
  • Description

    Rabbit polyclonal to EVL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human EVL.
    Sequence:

    SNSVEKPVSSILSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVK EEIIDAIRQELSGI

  • Positive control

    • Human tonsil tissue; U-2 OS cells.
  • General notes

     This product was previously labelled as Enah/Vasp-like

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use at an assay dependent concentration. Predicted molecular weight: 40 kDa.

Target

  • Relevance

    Enah/Vasp-like (EVL) is a member of the Ena/VASP protein family. Ena/VASP proteins are actin-associated proteins involved in a range of processes that require dynamic actin remodeling such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. EVL enhances actin nucleation and polymerization. There are two different isoforms, generated by alternative splicing.
  • Cellular localization

    Cytoplasm, cytoskeleton. Lamellipodium.
  • Database links

  • Alternative names

    • AI528774 antibody
    • Ena-vasodilator stimulated phosphoprotein antibody
    • Ena/vasodilator stimulated phosphoprotein like antibody
    • Ena/VASP like protein antibody
    • EVL antibody
    • RNB 6 antibody
    • RNB6 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded human lung tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Negative control: Immunohistochemical analysis of paraffin-embedded Human skeletal muscle tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Negative control: Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human tonsil tissue labeling EVL with ab204835 at 1/1000 dilution.

  • Immunofluorescent analysis of PFA- fixed, Triton X-100 permeabilized U-2 OS cells labeling EVL with ab204835 at 4 µg/ml (green).

  • Anti-EVL antibody (ab204835) + MOLT-4

    Secondary
    EVL

    Predicted band size: 40 kDa
    Observed band size: 55 kDa
    why is the actual band size different from the predicted?

References

ab204835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up