Anti-EVPL antibody (ab204237)
Key features and details
- Rabbit polyclonal to EVPL
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EVPL antibody
See all EVPL primary antibodies -
Description
Rabbit polyclonal to EVPL -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human EVPL aa 145-233.
Sequence:DVGPRVDWARVLEQKQKQVCAGQYGPGMAELEQQIAEHNILQKEIDAYGQ QLRSLVGPDAATIRSQYRDLLKAASWRGQSLGSLYTHLQ
Database link: Q92817 -
Positive control
- IHC-P: Human skin tissue; ICC: MCF7 whole cells.
-
General notes
Previously labelled as Envoplakin.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204237 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
EVPL is a component of the cornified envelope (epidermal barrier) and a member of the plakin family of cytoskeletal linker proteins. It is exclusively expressed in stratified squamous epithelia and is induced during differentiation of epidermal keratinocytes. -
Cellular localization
Cell junction; desmosome. Note=Colocalized with DSP at desmosomes and along intermediate filaments. -
Database links
- Entrez Gene: 2125 Human
- Entrez Gene: 14027 Mouse
- Entrez Gene: 303687 Rat
- Omim: 601590 Human
- SwissProt: Q92817 Human
- SwissProt: Q9D952 Mouse
- Unigene: 500635 Human
-
Alternative names
- 210 kDa cornified envelope antibody
- 210 kDa cornified envelope precursor protein antibody
- 210 kDa paraneoplastic pemphigus antigen antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVPL antibody (ab204237)
Immunohistochemical analysis of human skin tissue labeling EVPL (high expression) with ab204237 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunocytochemical analysis of MCF7 (Human breast adenocarcinoma cell line) whole cells labeling EVPL in the intermediate filaments with ab204237 at 2 µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EVPL antibody (ab204237)
Immunohistochemical analysis of human skeletal muscle tissue labeling EVPL (low expression) with ab204237 at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Datasheets and documents
References (0)
ab204237 has not yet been referenced specifically in any publications.