Overview

  • Product name

  • Description

    Rabbit polyclonal to Evx1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Evx1 aa 2-76.
    Sequence:

    ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPR AVPPATRERGGGGPEEEPVDGLAGS


    Database link: P49640

  • Positive control

    • RT4 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Relevance

    Evx1 belongs to the even-skipped homeobox family of proteins and contains a single homeobox DNA-binding domain. Evx1 may have a role in the specification of neuronal cell types.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Eve even skipped homeo box homolog 1 antibody
    • Eve even skipped homeobox homolog 1 antibody
    • Even skipped homeobox 1 antibody
    • Evx 1 antibody
    • Homeobox even skipped homolog protein 1 antibody
    see all

Images

  • Immunofluorescent analysis of RT4 cells (PFA-fixed/Triton X-100 permeabilized) labeling Evx1 with ab220665 at 4μg/ml (green).

References

ab220665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up