Overview

  • Product name

    Anti-Evx1 antibody [OTI1F8]
    See all Evx1 primary antibodies
  • Description

    Mouse monoclonal [OTI1F8] to Evx1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Evx1 aa 1-244. (NP_001980) produced in E.coli.
    Sequence:

    MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSP RAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPS VDSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKGSGSEALV GSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTREQIARLEK EFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLA


    Database link: P49640-1

  • Positive control

    • WB: pCMV6-ENTRY Evx1 cDNA transfected HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 42 kDa.

Target

  • Relevance

    Evx1 belongs to the even-skipped homeobox family of proteins and contains a single homeobox DNA-binding domain. Evx1 may have a role in the specification of neuronal cell types.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Eve even skipped homeo box homolog 1 antibody
    • Eve even skipped homeobox homolog 1 antibody
    • Even skipped homeobox 1 antibody
    • Evx 1 antibody
    • Homeobox even skipped homolog protein 1 antibody
    see all

Images

  • All lanes : Anti-Evx1 antibody [OTI1F8] (ab236382) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY Evx1 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 42 kDa

References

ab236382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up