Exendin (9-39) amide, GLP-1 receptor antagonist (ab141101)
Key features and details
- Potent, selective GLP-1 receptor antagonist
- CAS Number: 133514-43-9
- Purity: > 98%
- Soluble in water to 1mg/ml
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Exendin (9-39) amide, GLP-1 receptor antagonist -
Description
Potent, selective GLP-1 receptor antagonist -
Biological description
Potent, selective GLP-1 receptor antagonist (Kd = 1.7 nM). Inhibits the generation of intracellular cAMP induced by GLP-1 (7-36), exendin-3 and exendin-4 (ab120214). Role in appetite modulation, water and salt homeostasis and insulin release. Active in vivo.
-
Purity
> 98% -
CAS Number
133514-43-9 -
Chemical structure
Properties
-
Molecular weight
3369.79 -
Molecular formula
C149H234N40O47S -
Sequence
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (Modifications: C-terminal amide) -
PubChem identifier
129012199 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water to 1mg/ml -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (7)
ab141101 has been referenced in 7 publications.
- Saitoh Y et al. Improvement of hepatocyte engraftment by co-transplantation with pancreatic islets in hepatocyte transplantation. J Tissue Eng Regen Med 15:361-374 (2021). PubMed: 33484496
- Ohbayashi K et al. Gastrointestinal Distension by Pectin-Containing Carbonated Solution Suppresses Food Intake and Enhances Glucose Tolerance via GLP-1 Secretion and Vagal Afferent Activation. Front Endocrinol (Lausanne) 12:676869 (2021). PubMed: 34168616
- Tu Y et al. Geniposide Attenuates Hyperglycemia-Induced Oxidative Stress and Inflammation by Activating the Nrf2 Signaling Pathway in Experimental Diabetic Retinopathy. Oxid Med Cell Longev 2021:9247947 (2021). PubMed: 34938383
- Okabe K et al. DPP (Dipeptidyl Peptidase)-4 Inhibitor Attenuates Ang II (Angiotensin II)-Induced Cardiac Hypertrophy via GLP (Glucagon-Like Peptide)-1-Dependent Suppression of Nox (Nicotinamide Adenine Dinucleotide Phosphate Oxidase) 4-HDAC (Histone Deacetylase) 4 Pathway. Hypertension 75:991-1001 (2020). PubMed: 32160098
- Kim KH et al. Cucurbitacin B Induces Hypoglycemic Effect in Diabetic Mice by Regulation of AMP-Activated Protein Kinase Alpha and Glucagon-Like Peptide-1 via Bitter Taste Receptor Signaling. Front Pharmacol 9:1071 (2018). PubMed: 30298009
- Kim KS et al. Activation of intestinal olfactory receptor stimulates glucagon-like peptide-1 secretion in enteroendocrine cells and attenuates hyperglycemia in type 2 diabetic mice. Sci Rep 7:13978 (2017). PubMed: 29070885
- Hwang I et al. Alteration of gut microbiota by vancomycin and bacitracin improves insulin resistance via glucagon-like peptide 1 in diet-induced obesity. FASEB J 29:2397-411 (2015). PubMed: 25713030