Overview

  • Product name

  • Description

    Rabbit polyclonal to EXOSC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human EXOSC3 aa 2-275.
    Sequence:

    AEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVER PLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYW VDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATK RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK VTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILA NILEACEHMTSDQRKQIFSRLAES


    Database link: Q9NQT5

  • Positive control

    • IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    EXOSC3 is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions. It is required for the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA. Has a 3'-5' exonuclease activity. [Swiss-Prot]
  • Cellular localization

    Cytoplasm. Nucleus, nucleolus.
  • Database links

  • Alternative names

    • bA3J10.7 antibody
    • CGI 102 antibody
    • CGI-102 antibody
    • Exosome complex component RRP40 antibody
    • Exosome complex exonuclease RRP40 antibody
    • Exosome component 3 antibody
    • hRrp 40 antibody
    • hRrp-40 antibody
    • hRrp40 antibody
    • hRrp40p antibody
    • p10 antibody
    • PCH1B antibody
    • Ribosomal RNA processing protein 40 antibody
    • Ribosomal RNA-processing protein 40, S. cerevisiae, homolog of antibody
    • RP11-3J10.8 antibody
    • RRP 40 antibody
    • Rrp40 antibody
    • Rrp40p antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for EXOSC3 using ab235930 at 1/100 dilution in immunohistochemical analysis.

References

ab235930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up