Overview

  • Product name

  • Description

    Rabbit polyclonal to EXOSC8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human EXOSC8 aa 175-274.
    Sequence:

    ALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTI VMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMK


    Database link: Q96B26

  • Positive control

    • Human testis tissue, Hep-G2 cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC8 binds to ARE-containing RNAs.
  • Sequence similarities

    Belongs to the RNase PH family.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA421P11.3 antibody
    • CBP interacting protein 3 antibody
    • CIP3 antibody
    • EAP2 antibody
    • EC 3.1.13 antibody
    • EXOS8_HUMAN antibody
    • EXOSC8 antibody
    • Exosome complex component RRP43 antibody
    • Exosome complex exonuclease RRP43 antibody
    • Exosome component 8 antibody
    • OIP-2 antibody
    • OIP2 antibody
    • Opa interacting protein 2 antibody
    • Opa-interacting protein 2 antibody
    • OTTHUMP00000042274 antibody
    • p9 antibody
    • Ribosomal RNA processing protein 43 antibody
    • Ribosomal RNA processing protein 43, S. cerevisiae, homolog of antibody
    • Ribosomal RNA-processing protein 43 antibody
    • RP11 421P11.3 antibody
    • RRP43 antibody
    • Rrp43p antibody
    see all

Images

  • Immunofluorescence analysis of HepG2 cells labeling EXOSC8 with ab187905 at 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling EXOSC8 with ab187905 at 1/500 dilution.

References

ab187905 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up