Anti-EXOSC9 antibody (ab156686)
Key features and details
- Rabbit polyclonal to EXOSC9
- Suitable for: WB, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-EXOSC9 antibody
See all EXOSC9 primary antibodies -
Description
Rabbit polyclonal to EXOSC9 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan -
Immunogen
Synthetic peptide corresponding to Human EXOSC9 aa 389-439.
Sequence:IILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAA N
Database link: NP_005024.2 -
Positive control
- 293T, HeLa, NIH3T3 and Jurkat whole cell lysate (ab7899).
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab156686 was affinity purified using an epitope specific to EXOSC9 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab156686 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/2000 - 1/10000. Predicted molecular weight: 49 kDa.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
WB
1/2000 - 1/10000. Predicted molecular weight: 49 kDa. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Function
Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as anti-sense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC9 binds to ARE-containing RNAs. -
Sequence similarities
Belongs to the RNase PH family. -
Cellular localization
Nucleus > nucleolus; Cytoplasm. Nucleus > nucleolus and Nucleus. Excluded from the nucleolus. - Information by UniProt
-
Database links
- Entrez Gene: 100388650 Common marmoset
- Entrez Gene: 101129398 Gorilla
- Entrez Gene: 5393 Human
- Entrez Gene: 50911 Mouse
- Entrez Gene: 100452434 Orangutan
- Entrez Gene: 707368 Rhesus monkey
- Omim: 606180 Human
- SwissProt: Q06265 Human
see all -
Alternative names
- Autoantigen PM/Scl 1 antibody
- EXOS9_HUMAN antibody
- EXOSC 9 antibody
see all
Images
-
All lanes : Anti-EXOSC9 antibody (ab156686) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 49 kDa
Exposure time: 10 seconds -
All lanes : Anti-EXOSC9 antibody (ab156686) at 0.4 µg/ml
Lane 1 : Mouse NIH3T3 whole cell lysate at 50 µg
Lane 2 : Mouse NIH3T3 whole cell lysate at 15 µg
Developed using the ECL technique.
Predicted band size: 49 kDa
Exposure time: 3 seconds -
Detection of EXOSC9 by Western Blot of Immunoprecipitate.
Immunoprecipitation of 293T whole cell lysate using ab156686 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane) followed by detection 9 with ab156686 at 0.4 µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody. Detection: Chemiluminescence with exposure time of 3 seconds.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab156686 has been referenced in 1 publication.
- Burns DT et al. Variants in EXOSC9 Disrupt the RNA Exosome and Result in Cerebellar Atrophy with Spinal Motor Neuronopathy. Am J Hum Genet 102:858-873 (2018). WB ; Human . PubMed: 29727687