For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    exosc9-antibody-ab156686.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Immune System Diseases Autoimmune
Share by email

Anti-EXOSC9 antibody (ab156686)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-EXOSC9 antibody (ab156686)
  • Western blot - Anti-EXOSC9 antibody (ab156686)
  • Immunoprecipitation - Anti-EXOSC9 antibody (ab156686)

Key features and details

  • Rabbit polyclonal to EXOSC9
  • Suitable for: WB, IP
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-EXOSC9 antibody
    See all EXOSC9 primary antibodies
  • Description

    Rabbit polyclonal to EXOSC9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human EXOSC9 aa 389-439.
    Sequence:

    IILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAA N


    Database link: NP_005024.2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • 293T, HeLa, NIH3T3 and Jurkat whole cell lysate (ab7899).
  • General notes

     This product was previously labelled as Exosome Component 9

     

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab156686 was affinity purified using an epitope specific to EXOSC9 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Immunology
    • Immune System Diseases
    • Autoimmune
    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • RNA Processing
    • Other

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • HeLa whole cell lysate (ab150035)
    • HeLa whole cell lysate (ab29545)
    • NIH/3T3 whole cell lysate (ab7179)
    • Jurkat whole cell lysate (ab7899)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab156686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
1/2000 - 1/10000. Predicted molecular weight: 49 kDa.
IP
Use at 2-10 µg/mg of lysate.
Notes
WB
1/2000 - 1/10000. Predicted molecular weight: 49 kDa.
IP
Use at 2-10 µg/mg of lysate.

Target

  • Function

    Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as anti-sense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC9 binds to ARE-containing RNAs.
  • Sequence similarities

    Belongs to the RNase PH family.
  • Cellular localization

    Nucleus > nucleolus; Cytoplasm. Nucleus > nucleolus and Nucleus. Excluded from the nucleolus.
  • Target information above from: UniProt accession Q06265 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 100388650 Common marmoset
    • Entrez Gene: 101129398 Gorilla
    • Entrez Gene: 5393 Human
    • Entrez Gene: 50911 Mouse
    • Entrez Gene: 100452434 Orangutan
    • Entrez Gene: 707368 Rhesus monkey
    • Omim: 606180 Human
    • SwissProt: Q06265 Human
    • SwissProt: Q9JHI7 Mouse
    • Unigene: 91728 Human
    • Unigene: 116711 Mouse
    see all
  • Alternative names

    • Autoantigen PM/Scl 1 antibody
    • EXOS9_HUMAN antibody
    • EXOSC 9 antibody
    • EXOSC9 antibody
    • Exosome complex component RRP45 antibody
    • Exosome complex exonuclease RRP45 antibody
    • Exosome component 9 antibody
    • p5 antibody
    • p6 antibody
    • P75 polymyositis scleroderma overlap syndrome associated autoantigen antibody
    • P75 polymyositis-scleroderma overlap syndrome-associated autoantigen antibody
    • PM/Scl 75 antibody
    • PM/Scl-75 antibody
    • PMSCL autoantigen 75kD antibody
    • PMSCL1 antibody
    • Polymyositis/scleroderma autoantigen 1 75kDa antibody
    • Polymyositis/scleroderma autoantigen 1 antibody
    • Polymyositis/scleroderma autoantigen 75 kDa antibody
    • RRP45 antibody
    • Rrp45p antibody
    see all

Images

  • Western blot - Anti-EXOSC9 antibody (ab156686)
    Western blot - Anti-EXOSC9 antibody (ab156686)
    All lanes : Anti-EXOSC9 antibody (ab156686) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 49 kDa


    Exposure time: 10 seconds
  • Western blot - Anti-EXOSC9 antibody (ab156686)
    Western blot - Anti-EXOSC9 antibody (ab156686)
    All lanes : Anti-EXOSC9 antibody (ab156686) at 0.4 µg/ml

    Lane 1 : Mouse NIH3T3 whole cell lysate at 50 µg
    Lane 2 : Mouse NIH3T3 whole cell lysate at 15 µg

    Developed using the ECL technique.

    Predicted band size: 49 kDa


    Exposure time: 3 seconds
  • Immunoprecipitation - Anti-EXOSC9 antibody (ab156686)
    Immunoprecipitation - Anti-EXOSC9 antibody (ab156686)

    Detection of EXOSC9 by Western Blot of Immunoprecipitate.
    Immunoprecipitation of 293T whole cell lysate using ab156686 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane) followed by detection 9 with ab156686 at 0.4 µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody. Detection: Chemiluminescence with exposure time of 3 seconds.

Protocols

  • Western blot protocols
  • Immunoprecipitation protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (1)

Publishing research using ab156686? Please let us know so that we can cite the reference in this datasheet.

ab156686 has been referenced in 1 publication.

  • Burns DT  et al. Variants in EXOSC9 Disrupt the RNA Exosome and Result in Cerebellar Atrophy with Spinal Motor Neuronopathy. Am J Hum Genet 102:858-873 (2018). WB ; Human . PubMed: 29727687

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab156686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.