Overview

  • Product name

  • Description

    Rabbit polyclonal to EXOSC9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Macaque monkey, Rhesus monkey, Gorilla, Common marmoset, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human EXOSC9 aa 389-439.
    Sequence:

    IILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAA N


    Database link: NP_005024.2

  • Positive control

    • 293T, HeLa, NIH3T3 and Jurkat whole cell lysate (ab7899).
  • General notes

     This product was previously labelled as Exosome Component 9

     

Properties

Applications

Our Abpromise guarantee covers the use of ab156686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 49 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as anti-sense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC9 binds to ARE-containing RNAs.
  • Sequence similarities

    Belongs to the RNase PH family.
  • Cellular localization

    Nucleus > nucleolus; Cytoplasm. Nucleus > nucleolus and Nucleus. Excluded from the nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Autoantigen PM/Scl 1 antibody
    • EXOS9_HUMAN antibody
    • EXOSC 9 antibody
    • EXOSC9 antibody
    • Exosome complex component RRP45 antibody
    • Exosome complex exonuclease RRP45 antibody
    • Exosome component 9 antibody
    • p5 antibody
    • p6 antibody
    • P75 polymyositis scleroderma overlap syndrome associated autoantigen antibody
    • P75 polymyositis-scleroderma overlap syndrome-associated autoantigen antibody
    • PM/Scl 75 antibody
    • PM/Scl-75 antibody
    • PMSCL autoantigen 75kD antibody
    • PMSCL1 antibody
    • Polymyositis/scleroderma autoantigen 1 75kDa antibody
    • Polymyositis/scleroderma autoantigen 1 antibody
    • Polymyositis/scleroderma autoantigen 75 kDa antibody
    • RRP45 antibody
    • Rrp45p antibody
    see all

Images

  • All lanes : Anti-EXOSC9 antibody (ab156686) at 0.1 µg/ml

    Lane 1 : 293T whole cell lysate at 50 µg
    Lane 2 : 293T whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 49 kDa


    Exposure time: 10 seconds
  • All lanes : Anti-EXOSC9 antibody (ab156686) at 0.4 µg/ml

    Lane 1 : Mouse NIH3T3 whole cell lysate at 50 µg
    Lane 2 : Mouse NIH3T3 whole cell lysate at 15 µg

    Developed using the ECL technique.

    Predicted band size: 49 kDa


    Exposure time: 3 seconds
  • Detection of EXOSC9 by Western Blot of Immunoprecipitate.
    Immunoprecipitation of 293T whole cell lysate using ab156686 at 6µg/mg lysate (1 mg/IP; 20% of IP loaded/lane) followed by detection 9 with ab156686 at 0.4 µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody. Detection: Chemiluminescence with exposure time of 3 seconds.

References

This product has been referenced in:

  • Burns DT  et al. Variants in EXOSC9 Disrupt the RNA Exosome and Result in Cerebellar Atrophy with Spinal Motor Neuronopathy. Am J Hum Genet 102:858-873 (2018). WB ; Human . Read more (PubMed: 29727687) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up