Overview

  • Product name

    Anti-EXTL3 antibody
  • Description

    Rabbit polyclonal to EXTL3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human EXTL3 aa 2-245.
    Sequence:

    TGYTMLRNGGAGNGGQTCMLRWSNRIRLTWLSFTLFVILVFFPLIAHYYL TTLDEADEAGKRIFGPRVGNELCEVKHVLDLCRIRESVSEELLQLEAKRQ ELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEHSYKELMAQNQP KLSLPIRLLPEKDDAGLPPPKATRGCRLHNCFDYSRCPLTSGFPVYVYDS DQFVFGSYLDPLVKQAFQATARANVYVTENADIACLYVILVGEM


    Database link: O43909

  • Positive control

    • WB: EC109 and HEK-293T whole cell lysates. IHC-P: Human placenta tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab237484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 105 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Probable glycosyltransferase.
  • Tissue specificity

    Ubiquitous.
  • Pathway

    Glycan metabolism; heparan sulfate biosynthesis.
  • Sequence similarities

    Belongs to the glycosyltransferase 47 family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • botv antibody
    • DKFZp686C2342 antibody
    • Exostoses (multiple)-like 3 antibody
    • Exostoses-like 3 antibody
    • Exostosin-like 3 antibody
    • EXT-related protein 1 antibody
    • EXTL1L antibody
    • EXTL3 antibody
    • EXTL3_HUMAN antibody
    • EXTR1 antibody
    • Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferas antibody
    • Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase antibody
    • Hereditary multiple exostoses gene isolog antibody
    • KIAA0519 antibody
    • Multiple exostosis-like protein 3 antibody
    • Putative tumor suppressor protein EXTL3 antibody
    • REG antibody
    • Reg receptor antibody
    • REGR antibody
    • RPR antibody
    see all

Images

  • Paraffin-embedded human placenta tissue stained for EXTL3 using ab237484 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-EXTL3 antibody (ab237484) at 1/500 dilution

    Lane 1 : EC109 whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/150000 dilution
  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for EXTL3 (green) using ab237484 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab237484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up