Overview

  • Product name

    Anti-Extracellular matrix protein 1 antibody
    See all Extracellular matrix protein 1 primary antibodies
  • Description

    Rabbit polyclonal to Extracellular matrix protein 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Extracellular matrix protein 1 aa 386-540.
    Sequence:

    HPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKH KHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPAL CCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTS EPKEE


    Database link: Q16610

  • Positive control

    • WB: MCF7 whole cell lysate. IHC-P: Human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000.

Target

  • Function

    Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity.
  • Tissue specificity

    Expressed in breast cancer tissues. Little or no expression observed in normal breast tissues. Expressed in skin; wide expression is observed throughout the dermis with minimal expression in the epidermis.
  • Involvement in disease

    Defects in ECM1 are the cause of lipoid proteinosis (LiP) [MIM:247100]; also known as lipoid proteinosis of Urbach and Wiethe or hyalinosis cutis et mucosae. LiP is a rare autosomal recessive disorder characterized by generalized thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness. Histologically, there is widespread deposition of hyaline material and disruption/reduplication of basement membrane.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • ECM 1 antibody
    • Ecm1 antibody
    • ECM1_HUMAN antibody
    • Extracellular matrix protein 1 antibody
    • Secretory component p85 antibody
    • URBWD antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for Extracellular matrix protein 1 using ab234976 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for  30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Anti-Extracellular matrix protein 1 antibody (ab234976) at 1/500 dilution + MCF7 (Human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

References

ab234976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up