Anti-EYA1 antibody (ab194448)
Key features and details
- Mouse polyclonal to EYA1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EYA1 antibody -
Description
Mouse polyclonal to EYA1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment (GST-tag) corresponding to Human EYA1 aa 100-170.
Sequence:TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTE GGLSQSQSPGQTGFLSYGTSF
Database link: Q99502 -
Positive control
- EYA1 recombinant protein; Jurkat whole cell lysate (ab7899)
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituent: 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Whole antiserum -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab194448 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2500. Predicted molecular weight: 65 kDa. |
Target
-
Function
Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Seems to coactivate SIX2, SIX4 and SIX5. May be required for normal development of branchial arches, ear and kidney. -
Tissue specificity
In the embryo, highly expressed in kidney with lower levels in brain. Weakly expressed in lung. In the adult, highly expressed in heart and skeletal muscle. Weakly expressed in brain and liver. No expression in eye or kidney. -
Involvement in disease
Defects in EYA1 are the cause of branchiootorenal syndrome type 1 (BOR1) [MIM:113650]; also known as Melnick-Fraser syndrome. BOR is an autosomal dominant disorder manifested by various combinations of preauricular pits, branchial fistulae or cysts, lacrimal duct stenosis, hearing loss, structural defects of the outer, middle, or inner ear, and renal dysplasia. Associated defects include asthenic habitus, long narrow facies, constricted palate, deep overbite, and myopia. Hearing loss may be due to mondini type cochlear defect and stapes fixation. Penetrance of BOR syndrome is high, although expressivity can be extremely variable.
Defects in EYA1 are the cause of otofaciocervical syndrome (OFCS) [MIM:166780]. The syndrome is characterized by trophic alterations of the facies and shoulder girdle in addition to the malformations seen in BOR.
Defects in EYA1 are the cause of branchiootic syndrome type 1 (BOS1) [MIM:602588]; also known as BO syndrome type 1 or branchiootic dysplasia. Individuals with BOS1 are affected by the same branchial and otic anomalies as those seen in individuals with BOR1, but lack renal anomalies. -
Sequence similarities
Belongs to the HAD-like hydrolase superfamily. EYA family. -
Developmental stage
Detected in cytoplasm of somite cells at the beginning of fourth week of development. Detected in cytoplasm of limb bud cell between the sixth and eighth week of development. -
Post-translational
modificationsSumoylated by SUMO1. -
Cellular localization
Cytoplasm. Nucleus. Localizes at sites of DNA damage at double-strand breaks. - Information by UniProt
-
Database links
- Entrez Gene: 2138 Human
- Entrez Gene: 14048 Mouse
- Omim: 601653 Human
- SwissProt: Q99502 Human
- SwissProt: P97767 Mouse
- Unigene: 491997 Human
- Unigene: 250185 Mouse
-
Alternative names
- BOP antibody
- BOR antibody
- BOS1 antibody
see all
Images
-
Anti-EYA1 antibody (ab194448) at 1/1000 dilution + EYA1 recombinant protein (immunizing peptide) at 0.2 µg
Predicted band size: 65 kDa
Observed band size: 34 kDa why is the actual band size different from the predicted?The observed band size may not correspond to the predicted protein molecular weight as the immunogen (recombinant fragment) was used for the test lane.
-
Anti-EYA1 antibody (ab194448) at 1/500 dilution + Jurkat cell lysate at 50 µg
Predicted band size: 65 kDa
Datasheets and documents
References (0)
ab194448 has not yet been referenced specifically in any publications.