Overview

  • Product name

    Anti-Ezrin / Radixin / Moesin antibody
    See all Ezrin / Radixin / Moesin primary antibodies
  • Description

    Rabbit polyclonal to Ezrin / Radixin / Moesin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Ezrin/ Radixin/ Moesin aa 5-295. (Expressed in E.coli)
    Sequence:

    INVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKG YSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFL QVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLP QRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVN YFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKK FVIKPIDKKAPDFVFYAPRLRINKRILALCM


    Database link: P35241

  • Positive control

    • IHC-P: Human liver cancer and human kidney tissues. WB: Recombinant human Ezrin / Radixin / Moesin protein; Pig liver and kidney tissues; HeLa and HEK-293T cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab231642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Relevance

    Ezrin is a cytoplasmic peripheral membrane protein and functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated version representing a pseudogene (RDXP2) was assigned to Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was mapped to 11p by Southern and PCR analyses. Moesin is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.
  • Cellular localization

    Cell Membrane, Cytoskeleton and Cytoplasmic
  • Database links

  • Alternative names

    • CVIL antibody
    • CVL antibody
    • Cytovillin 2 antibody
    • Cytovillin antibody
    • Deafness autosomal recessive 24 antibody
    • DFNB24 antibody
    • DKFZp762H157 antibody
    • EZR antibody
    • FLJ26216 antibody
    • Membrane organizing extension spike protein antibody
    • MGC1584 antibody
    • MSN antibody
    • OTTHUMP00000017506 antibody
    • OTTHUMP00000017507 antibody
    • OTTHUMP00000023438 antibody
    • p81 antibody
    • RDX antibody
    • VIL2 antibody
    • Villin 2 antibody
    • Villin 2 ezrin antibody
    • Villin2 antibody
    see all

Images

  • All lanes : Anti-Ezrin / Radixin / Moesin antibody (ab231642) at 1 µg/ml

    Lane 1 : Pig liver tissue lysate.
    Lane 2 : Pig kidney tissue lysate.
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.
  • Anti-Ezrin / Radixin / Moesin antibody (ab231642) at 2 µg/ml + Recombinant human Ezrin / Radixin / Moesin protein.

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Ezrin / Radixin / Moesin using ab231642 at 20 µg/mL in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for Ezrin / Radixin / Moesin using ab231642 at 20 µg/mL in immunohistochemical analysis.

References

ab231642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up