Overview

  • Product name

  • Description

    Rabbit polyclonal to Ezrin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Rabbit, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Ezrin aa 1-295. N-terminal tags. Expressed in E. coli.
    Sequence:

    MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYV DNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQK LFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSE RLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEM YGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISF NDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRR


    Database link: P15311

  • Positive control

    • WB: Recombinant human Ezrin protein; HeLa whole cell lysate; human lung and porcine stomach tissue lysate. IHC-P: Human prostate gland cancer, kidney, stomach, pancreas, breast cancer and prostate cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 69 kDa.

Target

  • Function

    Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis.
  • Tissue specificity

    Expressed in cerebral cortex, basal ganglia, hippocampus, hypophysis, and optic nerve. Weakly expressed in brain stem and diencephalon. Stronger expression was detected in gray matter of frontal lobe compared to white matter (at protein level). Component of the microvilli of intestinal epithelial cells. Preferentially expressed in astrocytes of hippocampus, frontal cortex, thalamus, parahippocampal cortex, amygdala, insula, and corpus callosum. Not detected in neurons in most tissues studied.
  • Sequence similarities

    Contains 1 FERM domain.
  • Developmental stage

    Very strong staining is detected in the Purkinje cell layer and in part of the molecular layer of the infant brain compared to adult brain.
  • Post-translational
    modifications

    Phosphorylated by tyrosine-protein kinases.
  • Cellular localization

    Apical cell membrane. Cell projection. Cell projection > microvillus membrane. Cell projection > ruffle membrane. Cytoplasm > cell cortex. Cytoplasm > cytoskeleton. Localization to the apical membrane of parietal cells depends on the interaction with MPP5. Localizes to cell extensions and peripheral processes of astrocytes (By similarity). Microvillar peripheral membrane protein.
  • Information by UniProt
  • Database links

  • Alternative names

    • Villin 2 ezrin antibody
    • CVIL antibody
    • CVL antibody
    • Cytovillin 2 antibody
    • Cytovillin antibody
    • DKFZp762H157 antibody
    • Epididymis secretory protein Li 105 antibody
    • EZR antibody
    • EZRI_HUMAN antibody
    • Ezrin antibody
    • FLJ26216 antibody
    • HEL S 105 antibody
    • MGC1584 antibody
    • p81 antibody
    • VIL 2 antibody
    • VIL2 antibody
    • Villin 2 (ezrin) antibody
    • Villin 2 antibody
    • Villin-2 antibody
    • Villin2 antibody
    see all

Images

  • All lanes : Anti-Ezrin antibody (ab231907) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Human lung tissue lysate
    Lane 3 : Porcine stomach tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 69 kDa

  • Formalin-fixed, paraffin-embedded human prostate gland cancer tissue stained for Ezrin using ab231907 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Ezrin using ab231907 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for Ezrin using ab231907 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for Ezrin using ab231907 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for Ezrin using ab231907 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for Ezrin using ab231907 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Ezrin antibody (ab231907) at 1 µg/ml + Recombinant human Ezrin protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 69 kDa
    Observed band size: 39 kDa
    why is the actual band size different from the predicted?

References

ab231907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up