Overview

  • Product name

  • Description

    Rabbit polyclonal to FABP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Chicken
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Chicken FABP4 aa 1-125. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    MCDQFVGTWKLLSSENFEDYMKELGVGFATRKMAGVAKPNLTISINGDVI TIRSESTFKNTEISFKLGEEFDETTADDRKTKNVITLDNGTLKQVQKWDG KETVIKRKVVDGNLLVECTMNNVTS


    Database link: A0A1D5NYF3

  • Positive control

    • WB: Recombinant chicken FABP4; chicken thymus lysate; rat thymus and heart lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab231067 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.

Target

  • Function

    Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization

    Cytoplasm. Nucleus. Depending on the nature of the ligand, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus. Subject to constitutive nuclear export.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3T3-L1 lipid-binding protein antibody
    • 422/aP2 antibody
    • A-FABP antibody
    • adipocyte antibody
    • Adipocyte lipid binding protein antibody
    • Adipocyte lipid-binding protein antibody
    • Adipocyte protein AP2 antibody
    • Adipocyte-type fatty acid-binding protein antibody
    • AFABP antibody
    • ALBP antibody
    • ALBP/Ap2 antibody
    • aP2 antibody
    • Epididymis secretory protein Li 104 antibody
    • FABP antibody
    • FABP4 antibody
    • FABP4_HUMAN antibody
    • Fatty acid binding protein 4 adipocyte antibody
    • Fatty acid binding protein 4 antibody
    • Fatty acid binding protein adipocyte antibody
    • Fatty acid-binding protein 4 antibody
    • Fatty acid-binding protein antibody
    • HEL S 104 antibody
    • Lbpl antibody
    • Myelin P2 protein homolog antibody
    • P15 antibody
    • P2 adipocyte protein antibody
    • Protein 422 antibody
    see all

Images

  • Anti-FABP4 antibody (ab231067) at 2 µg/ml + Chicken thymus lysate
  • Anti-FABP4 antibody (ab231067) at 1 µg/ml + Rat heart lysate
  • Anti-FABP4 antibody (ab231067) at 2 µg/ml + Rat thymus lysate
  • Anti-FABP4 antibody (ab231067) at 2 µg/ml + Recombinant chicken FABP4 protein

References

ab231067 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231067.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up