Overview

  • Product name

  • Description

    Rabbit polyclonal to FABP5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) within Pig FABP5 aa 1-132 (N terminal). The exact sequence is proprietary. (Expressed in E.coli).
    Sequence:

    MASIQQLVGRWRLVESKGFDEYMKEVGVGMALRKMGAMAKPDCIITFDGK DLTIKTESTLKTTQFSCNLGQKFEETTADGRKTQTVCDFTNGELVQHQEW DGKESTITRKVENGKLVVVCVMNNVTCTRVYE


    Database link: Q2EN74

  • Positive control

    • WB: Recombinant pig FABP5; pig skin and pancreas lysates.
  • General notes

     This product was previously labelled as Fatty Acid Binding Protein 5

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function

    High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.
  • Tissue specificity

    Keratinocytes; highly expressed in psoriatic skin.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Alternative names

    • CFABP antibody
    • Cutaneous fatty acid binding protein antibody
    • DA11 antibody
    • Differentiation associated lipid binding protein LP2 antibody
    • E-FABP antibody
    • EFABP antibody
    • Epidermal-type fatty acid-binding protein antibody
    • FABP5 antibody
    • FABP5_HUMAN antibody
    • fatty acid binding protein 5 (psoriasis-associated) antibody
    • Fatty acid binding protein epidermal antibody
    • Fatty acid-binding protein 5 antibody
    • Fatty acid-binding protein, epidermal antibody
    • Keratinocyte lipid binding protein antibody
    • KFABP antibody
    • Klbp antibody
    • mal1 antibody
    • PA-FABP antibody
    • PAFABP antibody
    • Psoriasis associated fatty acid binding protein homolog antibody
    • Psoriasis-associated fatty acid-binding protein homolog antibody
    see all

Images

  • Anti-FABP5 antibody (ab231143) at 1 µg/ml + Pig pancreas lysate.

    Predicted band size: 15 kDa

  • Anti-FABP5 antibody (ab231143) at 1 µg/ml + Pig skin lysate.

    Predicted band size: 15 kDa

  • Anti-FABP5 antibody (ab231143) at 1 µg/ml + Recombinant FABP5.

    Predicted band size: 15 kDa

References

ab231143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up