Overview

  • Product name

  • Description

    Rabbit polyclonal to FABP9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat FABP9 aa 1-130. (Linked with GCSSRHHHHHH; Expressed in E.coli).
    Sequence:

    MIEPFLGTWKLVSSENFENYVRELGVECEPRKVACLIKPSVSISFNGERM DIQAGSACRNTEISFKLGEEFEETTADNRKVKSLITFEGGSMIQIQRWLG KQTTIKRRIVDGRMVVECTMNNVVSTRTYE


    Database link: P55054

  • Positive control

    • IHC-P: Rat stomach, skin, spinal cord and testis tissues. WB: Recombinant rat FABP9 protein; Mouse and rat testis lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231531 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231531 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 15 kDa perforatorial protein antibody
    • Fabp9 antibody
    • FABP9_HUMAN antibody
    • Fatty acid binding protein 9, testis antibody
    • Fatty acid-binding protein 9 antibody
    • PERF antibody
    • PERF15 antibody
    • T-FABP antibody
    • Testis lipid-binding protein antibody
    • Testis-type fatty acid-binding protein antibody
    • TLBP antibody
    see all

Images

  • Anti-FABP9 antibody (ab231531) at 3 µg/ml + Rat testis lysate.

    Predicted band size: 15 kDa

  • Anti-FABP9 antibody (ab231531) at 3 µg/ml + Mouse testis lysate

    Predicted band size: 15 kDa

  • Anti-FABP9 antibody (ab231531) at 2 µg/ml + Recombinant rat FABP9 protein.

    Predicted band size: 15 kDa

  • Paraffin-embedded rat spinal cord tissue stained for FABP9 using ab231531 at 20 μg/ml in immunohistochemical analysis. DAb staining.

  • Paraffin-embedded rat skin tissue stained for FABP9 using ab231531 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for FABP9 using ab231531 at 10 μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for FABP9 using ab231531 at 20 μg/ml in immunohistochemical analysis.

References

ab231531 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231531.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up