Overview

  • Product name

  • Description

    Rabbit polyclonal to Factor B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Factor B aa 34-159. (N-terminal His-tag and GST-tag. Expressed in E.coli).
    Sequence:

    VSCSLEGVEIKGGSFQLLQDGQALEYLCPSGFYPYPVQTRTCKSTGSWSV LQTRDQKIVKKAECRAIRCPRPQDFENGEFWPRSPYYNLSDQISFQCYDG YTLRGSANRTCQENGRWDGQTAICDD


    Database link: G3V615

  • Positive control

    • WB: Recombinant rat Factor B protein; Rat serum and blood cell lysate; Mouse serum. IHC-P: Rat liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231072 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 85 kDa.

Target

  • Function

    Factor B which is part of the alternate pathway of the complement system is cleaved by factor D into 2 fragments: Ba and Bb. Bb, a serine protease, then combines with complement factor 3b to generate the C3 or C5 convertase. It has also been implicated in proliferation and differentiation of preactivated B-lymphocytes, rapid spreading of peripheral blood monocytes, stimulation of lymphocyte blastogenesis and lysis of erythrocytes. Ba inhibits the proliferation of preactivated B-lymphocytes.
  • Involvement in disease

    Defects in CFB are a cause of susceptibility to hemolytic uremic syndrome atypical type 4 (AHUS4) [MIM:612924]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 3 Sushi (CCP/SCR) domains.
    Contains 1 VWFA domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AHUS4 antibody
    • B factor properdin antibody
    • BF antibody
    • BFD antibody
    • C3 proaccelerator antibody
    • C3 proactivator antibody
    • C3/C5 convertase antibody
    • CFAB antibody
    • CFAB_HUMAN antibody
    • CFB antibody
    • Complement Factor B antibody
    • Complement factor B Bb fragment antibody
    • FB antibody
    • FBI12 antibody
    • GBG antibody
    • Glycine rich beta glycoprotein antibody
    • Glycine-rich beta glycoprotein antibody
    • H2 Bf antibody
    • H2BF antibody
    • PBF2 antibody
    • Properdin factor B antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Factor B using ab231072 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Factor B antibody (ab231072) at 1 µg/ml + Rat serum

    Predicted band size: 85 kDa

  • Anti-Factor B antibody (ab231072) at 2 µg/ml + Rat blood cell lysate

    Predicted band size: 85 kDa

  • Anti-Factor B antibody (ab231072) at 1 µg/ml + Mouse serum

    Predicted band size: 85 kDa

  • Anti-Factor B antibody (ab231072) at 2 µg/ml + Recombinant rat Factor B protein

    Predicted band size: 85 kDa

References

ab231072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up