Overview

  • Product name

    Anti-Factor I/CFI antibody
    See all Factor I/CFI primary antibodies
  • Description

    Rabbit polyclonal to Factor I/CFI
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Factor I/CFI aa 28-243. (N-terminal His-tag and GST-tags; Expressed in E.coli).
    Sequence:

    LVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCAT NRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIV EVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSIN STECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFF QCVNGKYISQMKACDG


    Database link: P05156

  • Positive control

    • WB: Pig kidney lysate; Recombinant human Factor I/CFI protein. IHC-P: Human kidney tissue.
  • General notes

     This product was previously labelled as Factor I

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 66 kDa.

Target

  • Function

    Responsible for cleaving the alpha-chains of C4b and C3b in the presence of the cofactors C4-binding protein and factor H respectively.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Defects in CFI are a cause of susceptibility to hemolytic uremic syndrome atypical type 3 (AHUS3) [MIM:612923]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype.
    Defects in CFI are the cause of complement factor I deficiency (CFI deficiency) [MIM:610984]. CFI deficiency is an autosomal recessive condition associated with a propensity to pyogenic infections.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 Kazal-like domain.
    Contains 2 LDL-receptor class A domains.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • AHUS3 antibody
    • ARMD13 antibody
    • C3b INA antibody
    • C3b inactivator antibody
    • C3B/C4B inactivator antibody
    • C3BINA antibody
    • CFAI_HUMAN antibody
    • Cfi antibody
    • Complement component I antibody
    • Complement control protein factor I antibody
    • Complement factor I antibody
    • Complement factor I heavy chain antibody
    • Complement factor I light chain antibody
    • F1 antibody
    • factor I antibody
    • FactorI antibody
    • FI antibody
    • I factor antibody
    • IF antibody
    • KAF antibody
    • Konglutinogen activating factor antibody
    • Light chain of factor I antibody
    • OTTHUMP00000219728 antibody
    • OTTHUMP00000221928 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Factor I/CFI using ab232743 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-Factor I/CFI antibody (ab232743) at 3 µg/ml + Pig kidney tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 66 kDa

  • Anti-Factor I/CFI antibody (ab232743) at 3 µg/ml + Recombinant human Factor I/CFI protein

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 66 kDa

References

ab232743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up