Anti-Factor V antibody (ab234849)
Key features and details
- Rabbit polyclonal to Factor V
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Factor V antibody
See all Factor V primary antibodies -
Description
Rabbit polyclonal to Factor V -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Factor V aa 1490-1614.
Sequence:MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYA EIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEI SWDYSEFVQRETDIEDSDDIPEDTT
Database link: P12259 -
Positive control
- IHC-P: Human liver cancer tissue. ICC/IF: HepG2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab234849 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin. -
Tissue specificity
Plasma. -
Involvement in disease
Factor V deficiency
Thrombophilia due to activated protein C resistance
Budd-Chiari syndrome
Ischemic stroke
Pregnancy loss, recurrent, 1 -
Sequence similarities
Belongs to the multicopper oxidase family.
Contains 3 F5/8 type A domains.
Contains 2 F5/8 type C domains.
Contains 6 plastocyanin-like domains. -
Domain
Domain B contains 35 x 9 AA tandem repeats, and 2 x 17 AA repeats. -
Post-translational
modificationsThrombin activates factor V proteolytically to the active cofactor, factor Va (formation of a heavy chain at the N-terminus and a light chain at the C-terminus).
Sulfation is required for efficient thrombin cleavage and activation and for full procoagulant activity.
Activated protein C inactivates factor V and factor Va by proteolytic degradation.
Phosphorylation sites are present in the extracellular medium. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 2153 Human
- Omim: 612309 Human
- SwissProt: P12259 Human
- Unigene: 30054 Human
-
Alternative names
- Activated protein C cofactor antibody
- APC cofactor antibody
- coagulation factor V (proaccelerin, labile factor) antibody
see all
Images
-
HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for Factor V using ab234849 at a dilution of 1/100 in ICC/IF. Secondary antibody used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Factor V antibody (ab234849)
Paraffin-embedded human liver cancer tissue stained for Factor V with ab234849 (1/100 dilution) in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab234849 has not yet been referenced specifically in any publications.