Anti-Factor V antibody (ab234849)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Factor V antibody
See all Factor V primary antibodies -
Description
Rabbit polyclonal to Factor V -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Factor V aa 1490-1614.
Sequence:MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYA EIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEI SWDYSEFVQRETDIEDSDDIPEDTT
Database link: P12259 -
Positive control
- IHC-P: Human liver cancer tissue. ICC/IF: HepG2 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab234849 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin. -
Tissue specificity
Plasma. -
Involvement in disease
Factor V deficiency
Thrombophilia due to activated protein C resistance
Budd-Chiari syndrome
Ischemic stroke
Pregnancy loss, recurrent, 1 -
Sequence similarities
Belongs to the multicopper oxidase family.
Contains 3 F5/8 type A domains.
Contains 2 F5/8 type C domains.
Contains 6 plastocyanin-like domains. -
Domain
Domain B contains 35 x 9 AA tandem repeats, and 2 x 17 AA repeats. -
Post-translational
modificationsThrombin activates factor V proteolytically to the active cofactor, factor Va (formation of a heavy chain at the N-terminus and a light chain at the C-terminus).
Sulfation is required for efficient thrombin cleavage and activation and for full procoagulant activity.
Activated protein C inactivates factor V and factor Va by proteolytic degradation.
Phosphorylation sites are present in the extracellular medium. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 2153 Human
- Omim: 612309 Human
- SwissProt: P12259 Human
- Unigene: 30054 Human
-
Alternative names
- Activated protein C cofactor antibody
- APC cofactor antibody
- coagulation factor V (proaccelerin, labile factor) antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-Factor V antibody (ab234849)HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for Factor V using ab234849 at a dilution of 1/100 in ICC/IF. Secondary antibody used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Factor V antibody (ab234849)Paraffin-embedded human liver cancer tissue stained for Factor V with ab234849 (1/100 dilution) in immunohistochemical analysis.
References
ab234849 has not yet been referenced specifically in any publications.
