Overview

  • Product name

    Anti-Factor V antibody - N-terminal
    See all Factor V primary antibodies
  • Description

    Rabbit polyclonal to Factor V - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Synthetic peptide within Human Factor V aa 19-64 (N terminal). The exact sequence is proprietary.
    Sequence:

    VGWGSQGTEAAQLRQFYVAAQGISWSYRPEPTNSSLNLSVTSFKKI


    Database link: P12259

  • Positive control

    • HEK293T and PC12 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.097% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 252 kDa.

Target

  • Function

    Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Factor V deficiency
    Thrombophilia due to activated protein C resistance
    Budd-Chiari syndrome
    Ischemic stroke
    Pregnancy loss, recurrent, 1
  • Sequence similarities

    Belongs to the multicopper oxidase family.
    Contains 3 F5/8 type A domains.
    Contains 2 F5/8 type C domains.
    Contains 6 plastocyanin-like domains.
  • Domain

    Domain B contains 35 x 9 AA tandem repeats, and 2 x 17 AA repeats.
  • Post-translational
    modifications

    Thrombin activates factor V proteolytically to the active cofactor, factor Va (formation of a heavy chain at the N-terminus and a light chain at the C-terminus).
    Sulfation is required for efficient thrombin cleavage and activation and for full procoagulant activity.
    Activated protein C inactivates factor V and factor Va by proteolytic degradation.
    Phosphorylation sites are present in the extracellular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Activated protein C cofactor antibody
    • APC cofactor antibody
    • coagulation factor V (proaccelerin, labile factor) antibody
    • Coagulation factor V antibody
    • coagulation factor V jinjiang A2 domain antibody
    • Coagulation factor V light chain antibody
    • F5 antibody
    • FA5_HUMAN antibody
    • Factor V Leiden antibody
    • FactorV antibody
    • FVL antibody
    • Labile factor antibody
    • PCCF antibody
    • Proaccelerin antibody
    • proaccelerin, labile factor antibody
    • Protein C cofactor antibody
    • RPRGL1 antibody
    • THPH2 antibody
    see all

Images

  • All lanes : Anti-Factor V antibody - N-terminal (ab200680)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : PC12 whole cell lysate

    Predicted band size: 252 kDa

References

ab200680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up