Overview

  • Product name

  • Description

    Rabbit polyclonal to Factor VIII
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Factor VIII aa 1-216. Isoform 2
    Sequence:

    MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMEL MGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRS NAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQ DGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQ IALRMEVLGCEAQDLY


    Database link: P00451

  • Positive control

    • IHC-P: Human placenta and renal tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Factor VIII, along with calcium and phospholipid, acts as a cofactor for factor IXa when it converts factor X to the activated form, factor Xa.
  • Involvement in disease

    Defects in F8 are the cause of hemophilia A (HEMA) [MIM:306700]. A disorder of blood coagulation characterized by a permanent tendency to hemorrhage. About 50% of patients have severe hemophilia resulting in frequent spontaneous bleeding into joints, muscles and internal organs. Less severe forms are characterized by bleeding after trauma or surgery. Note=Of particular interest for the understanding of the function of F8 is the category of CRM (cross-reacting material) positive patients (approximately 5%) that have considerable amount of F8 in their plasma (at least 30% of normal), but the protein is non-functional; i.e., the F8 activity is much less than the plasma protein level. CRM-reduced is another category of patients in which the F8C antigen and activity are reduced to approximately the same level. Most mutations are CRM negative, and probably affect the folding and stability of the protein.
  • Sequence similarities

    Belongs to the multicopper oxidase family.
    Contains 3 F5/8 type A domains.
    Contains 2 F5/8 type C domains.
    Contains 6 plastocyanin-like domains.
  • Domain

    Domain F5/8 type C 2 is responsible for phospholipid-binding and essential for factor VIII activity.
  • Post-translational
    modifications

    Sulfation on Tyr-1699 is essential for binding vWF.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • AHF antibody
    • Antihemophilic factor antibody
    • Coagulation factor VIII antibody
    • coagulation factor VIII, procoagulant component antibody
    • coagulation factor VIIIc antibody
    • DXS1253E antibody
    • F8 antibody
    • F8b antibody
    • F8c antibody
    • FA8_HUMAN antibody
    • factor VIII F8B antibody
    • Factor VIIIa light chain antibody
    • FactorVIII antibody
    • FVIII antibody
    • Hema antibody
    • Hemophilia A antibody
    • Hemophilia, classic antibody
    • OTTHUMP00000061446 antibody
    • OTTHUMP00000196174 antibody
    • Procoagulant component antibody
    see all

Images

  • Paraffin-embedded human placental tissue stained for Factor VIII using ab236284 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human renal tissue stained for Factor VIII using ab236284 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling Factor VIII using ab236284 at 1/100 dilution in ICC/IF, followed by an Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up