Overview

  • Product name

  • Description

    Rabbit polyclonal to Factor XIa
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Rat Factor XIa aa 275-516. N-terminal His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    IPVFCHPNFYNDTDFLGEELDIVDVKGKESCQKMCSDNVRCQFFTYYPSR GSCSERNMHNQNQAQGVRRSCVCSRRVAMAGDPAHHPGTPVWRLHHWKPV DIDSGSLFLWVSINDIRLGSSSPSTETPKTLRVYGGIVNQSEINEDTTFF RVQEMIIHDQYTSAESGFDIALLKLEPAMNYTDEVQSTLQKAKVPLVSNE ECQTRYRKHKITNKVICAGYKEGGKDTCKGDSGGPLSCKHNG


    Database link: Q6TUF8

  • Positive control

    • WB: Recombinant rat Factor XIa protein and HepG2 whole cell lysate (ab7900). IHC-P: Rat liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 63 kDa.

Target

  • Function

    Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
  • Tissue specificity

    Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells.
  • Involvement in disease

    Defects in F11 are the cause of factor XI deficiency (FA11D) [MIM:612416]; also known as plasma thromboplastin antecedent deficiency or Rosenthal syndrome. It is a hemorrhagic disease characterized by reduced levels and activity of factor XI resulting in moderate bleeding symptoms, usually occurring after trauma or surgery. Patients usually do not present spontaneous bleeding but women can present with menorrhagia. Hemorrhages are usually moderate.
  • Sequence similarities

    Belongs to the peptidase S1 family. Plasma kallikrein subfamily.
    Contains 4 apple domains.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    Activated by factor XIIa (or XII), which cleaves each polypeptide after Arg-387 into the light chain, which contains the active site, and the heavy chain, which associates with high molecular weight (HMW) kininogen.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • coagulation factor XI antibody
    • Coagulation factor XIa light chain antibody
    • F11 antibody
    • FA11_HUMAN antibody
    • FXI antibody
    • MGC141891 antibody
    • Plasma thromboplastin antecedent antibody
    • Platelet coagulation factor XI antibody
    • PTA antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Factor XIa using ab232726 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Factor XIa antibody (ab232726) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 63 kDa

  • Anti-Factor XIa antibody (ab232726) at 2 µg/ml + Recombinant rat Factor XIa protein

    Predicted band size: 63 kDa

References

ab232726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up