Overview

  • Product name

  • Description

    Rabbit polyclonal to Factor XIII
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Factor XIII aa 467-611.
    Sequence:

    EMKWKYEGKVLHGDLIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCT RKESKGMCTSPPLIKHGVIISSTVDTYENGSSVEYRCFDHHFLEGSREAY CLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDFDNRPHILHGEY


    Database link: P05160

  • Positive control

    • Human skin tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Factor XIII is activated by thrombin and calcium ions to a transglutaminase that catalyzes the formation of gamma-glutamyl- epsilon-lysine cross-links between fibrin chains, thus stabilizing the fibrin clot. It also cross-links alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII belongs to the transglutaminase family.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • Coagulation factor XIII, A2 polypeptide antibody
    • Coagulation factor XIII, B polypeptide antibody
    • F13A2 antibody
    • F13B antibody
    • FXIIIB antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human skin tissue labeling Factor XIII with ab204054 at 1/50 dilution.

References

ab204054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up