Overview

  • Product name

  • Description

    Rabbit polyclonal to FADD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Mouse FADD aa 10-60 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFTVLLEQNDLERGH T


    Database link: Q61160

  • Positive control

    • Mouse liver and brain lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab216506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 23 kDa (predicted molecular weight: 23 kDa).
IHC-P 1/400.

Target

  • Function

    Apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation. Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis.
  • Tissue specificity

    Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes.
  • Sequence similarities

    Contains 1 death domain.
    Contains 1 DED (death effector) domain.
  • Domain

    Contains a death domain involved in the binding of the corresponding domain within Fas receptor.
  • Information by UniProt
  • Database links

  • Alternative names

    • FADD antibody
    • FADD protein antibody
    • FADD_HUMAN antibody
    • Fas (TNFRSF6) associated via death domain antibody
    • Fas associated via death domain antibody
    • Fas associating death domain containing protein antibody
    • Fas associating protein antibody
    • Fas associating protein with death domain antibody
    • Fas TNFRSF6 associated via death domain antibody
    • FAS-associated death domain protein antibody
    • FAS-associating death domain-containing protein antibody
    • GIG 3 antibody
    • GIG3 antibody
    • Growth inhibiting gene 3 protein antibody
    • Growth-inhibiting gene 3 protein antibody
    • H sapiens mRNA for mediator of receptor induced toxicity antibody
    • Mediator of receptor induced toxicity antibody
    • MGC8528 antibody
    • MORT 1 antibody
    • MORT1 antibody
    • Protein FADD antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of Rat Kidney with ab216506 at 1/400
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of Rat Brain with ab216506 at 1/400
  • All lanes : Anti-FADD antibody (ab216506) at 1/200 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : Mouse brain lysate

    Predicted band size: 23 kDa
    Observed band size: 23 kDa



    12% gel

References

ab216506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up