Overview

  • Product name

    Anti-FADS3 antibody - N-terminal
    See all FADS3 primary antibodies
  • Description

    Rabbit polyclonal to FADS3 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
  • Immunogen

    Synthetic peptide within Rat FADS3 aa 51-100 (N terminal). The exact sequence is proprietary. NP_775160.1
    Sequence:

    DISRWAQRHPGGSRLIGHHSAEDATDAFHAFHQDLHFVRKFLKPLLIGEL


    Database link: Q8K1P9

Properties

Applications

Our Abpromise guarantee covers the use of ab175011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa.

Target

  • Tissue specificity

    Has been found in heart, liver, lung, uterus, and brainstem.
  • Sequence similarities

    Belongs to the fatty acid desaturase family.
    Contains 1 cytochrome b5 heme-binding domain.
  • Domain

    The histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CYB5RP antibody
    • Cytochrome b5 related protein antibody
    • Cytochrome b5-related protein antibody
    • Delta 9 desaturase antibody
    • Delta 9 fatty acid desaturase antibody
    • FADS 3 antibody
    • FADS3 antibody
    • FADS3_HUMAN antibody
    • Fatty acid desaturase 3 antibody
    • Linoleoyl CoA desaturase (delta 9 desaturase) like 3 antibody
    • Linoleoyl CoA desaturase like 3 antibody
    • LLCDL 3 antibody
    • LLCDL3 antibody
    • OTTHUMP00000236055 antibody
    • OTTHUMP00000236056 antibody
    • OTTHUMP00000236059 antibody
    see all

Images

  • Anti-FADS3 antibody - N-terminal (ab175011) at 1 µg/ml + Rat kidney lysate

    Predicted band size: 51 kDa

References

ab175011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up