Anti-FAF1 antibody (ab222907)
Key features and details
- Rabbit polyclonal to FAF1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-FAF1 antibody
See all FAF1 primary antibodies -
Description
Rabbit polyclonal to FAF1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Recombinant fragment corresponding to Human FAF1 aa 490-629.
Sequence:QQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRL EQIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERR FLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDP
Database link: Q9UNN5-1 -
Positive control
- WB: HeLa, HEK-293 and THP-1 whole cell lysate. Mouse heart and brain tissue lysate. IHC-P: Human testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab222907 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Potentiates but cannot initiate FAS-induced apoptosis. -
Tissue specificity
Most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon. Not detected in the peripheral blood leukocytes. -
Sequence similarities
Contains 1 UBX domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 11124 Human
- Entrez Gene: 14084 Mouse
- Entrez Gene: 140657 Rat
- Omim: 604460 Human
- SwissProt: Q9UNN5 Human
- SwissProt: P54731 Mouse
- SwissProt: Q924K2 Rat
- Unigene: 530402 Human
see all -
Alternative names
- CGI 03 antibody
- FAF1 antibody
- FAF1 protein antibody
see all
Images
-
All lanes : Anti-FAF1 antibody (ab222907) at 1/500 dilution
Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
Lane 3 : THP-1 (human monocytic leukemia cell line) whole cell lysate
Lane 4 : Mouse heart tissue lysate
Lane 5 : Mouse brain tissue lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Observed band size: 74 kDa why is the actual band size different from the predicted? -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAF1 antibody (ab222907)
Paraffin embedded human testis tissue stained for FAF1 with ab222907 (1/100 dilution) in immunohistochemical analysis.
Protocols
References (0)
ab222907 has not yet been referenced specifically in any publications.