Overview

  • Product name

    Anti-FAHD1/Oxaloacetate decarboxylase antibody
    See all FAHD1/Oxaloacetate decarboxylase primary antibodies
  • Description

    Rabbit polyclonal to FAHD1/Oxaloacetate decarboxylase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FAHD1/Oxaloacetate decarboxylase aa 1-107.
    Sequence:

    MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPST AYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALC LDMTARD


    Database link: Q6P587

  • Positive control

    • IHC-P: Human kidney tissue.
  • General notes

     This product was previously labelled as FAHD1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • All lanes : Anti-FAHD1/Oxaloacetate decarboxylase antibody (ab220069) at 0.4 µg/ml

    Lane 1 : MCF-7 whole cell lysate
    Lane 2 : U-251 MG whole cell lysate
  • Immunohistochemical analysis of paraffin-embedded human kidney tissue labeling FAHD1/Oxaloacetate decarboxylase with ab220069 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human lymph node tissue staining FAHD1/Oxaloacetate with ab220069 at 1/200 dilution.

References

ab220069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220069.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up