Overview

  • Product name
  • Description
    Rabbit polyclonal to FAIM1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human FAIM1 aa 1-179.
    Sequence:

    MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG KETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTW VLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCY IKAVSSGKRKEGIIHTLIVDNREIPEIAS


    Database link: Q9NVQ4

  • Positive control
    • 293 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab175303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 20 kDa.

Target

Images

  • Anti-FAIM1 antibody (ab175303) at 1/500 dilution + 293 cell lysate

    Predicted band size: 20 kDa

References

ab175303 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up