Overview

  • Product name

  • Description

    Mouse polyclonal to FAIM2/LFG
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein (GST-tag) corresponding to Human FAIM2/LFG aa 1-316.
    Sequence:

    MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAG AFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRR VFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFA TYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLG ITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYV PWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDI IYIFTFFLQLFGTNRE


    Database link: Q9BWQ8

  • Positive control

    • NIH3T3, A431, PC12 cell lysates; recombinant immunogen.
  • General notes

     This product was previously labelled as FAIM2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab194435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 35 kDa.

Target

  • Function

    Protects cells uniquely from Fas-induced apoptosis.
  • Tissue specificity

    Widely expressed. Expressed at high levels in the brain especially in the hippocampus.
  • Sequence similarities

    Belongs to the BI1 family.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FAIM 2 antibody
    • Faim2 antibody
    • FAIM2_HUMAN antibody
    • Fas apoptotic inhibitory molecule 2 antibody
    • KIAA0950 antibody
    • LFG antibody
    • Lifeguard antibody
    • Neural membrane protein 35 antibody
    • NGP 35 antibody
    • NGP35 antibody
    • NMP 35 antibody
    • NMP35 antibody
    • Protein lifeguard antibody
    • TMBIM 2 antibody
    • TMBIM2 antibody
    • Transmembrane BAX inhibitor motif containing 2 antibody
    • Transmembrane BAX inhibitor motif containing protein 2 antibody
    • Transmembrane BAX inhibitor motif-containing protein 2 antibody
    see all

Images

  • Anti-FAIM2/LFG antibody (ab194435) at 1/1000 dilution + recombinant immunogen at 0.2 µg

    Predicted band size: 35 kDa

  • Anti-FAIM2/LFG antibody (ab194435) at 1/500 dilution + NIH3T3 cell lysate at 50 µg

    Predicted band size: 35 kDa

  • Anti-FAIM2/LFG antibody (ab194435) at 1/500 dilution + A431 cell lysate at 50 µg

    Predicted band size: 35 kDa

  • Anti-FAIM2/LFG antibody (ab194435) at 1/500 dilution + PC12 cell lysate at 50 µg

    Predicted band size: 35 kDa

References

ab194435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up