Overview

  • Product name

    Anti-FAM118A antibody
  • Description

    Rabbit polyclonal to FAM118A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FAM118A aa 51-357.
    Sequence:

    SWRSCIEAVIEAAEQLEVLHPGDVAEFRRKVTKDRDLLVVAHDLIRKMSP RTGDAKPSFFQDCLMEVFDDLEQHIRSPVVLQSILSLMDRGAMVLTTNYD NLLEAFGRRQNKPMESLDLKDKTKVLEWARGHMKYGVLHIHGLYTDPCGV VLDPSGYKDVTQDAEVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYS VPNKVDLEHYMLVLKENEDHFFKHQADMLLHGIKVVSYGDCFDHFPGYVQ DLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIEVSKKRTQSD TDDAGGS


    Database link: Q9NWS6-1

  • Positive control

    • WB: HEK-293T whole cell lysate. IHC-P: Human kidney and skin tissues. ICC/IF: HEK-293T and MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-FAM118A antibody (ab236792) at 1/500 dilution + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 40 kDa

  • Paraffin-embedded human kidney tissue tissue stained for FAM118A using ab236792 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue tissue stained for FAM118A using ab236792 at 1/100 dilution in immunohistochemical analysis.

  • HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells stained for FAM118A (green) using ab236792 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

  • MCF7 (Human breast adenocarcinoma cell line) cells stained for FAM118A (green) using ab236792 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up