Overview

  • Product name

  • Description

    Rabbit polyclonal to FAM123B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FAM123B aa 513-592.
    Sequence:

    DSLENSPPGDDCLYDLHGRSSEMFDPFLNFEPFLSSRPPGAMETEEERLV TIQKQLLYWELRREQLEAQEARAREAHARE


    Database link: Q5JTC6

  • Positive control

    • ICC/IF: CACO-2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221578 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    FAM123B enhances trancription activation by WT1. It also promotes CTNNB1 ubiquitination and degradation and antagonizes Wnt and CTNNB1 signaling. FAM123B is involved in kidney development.
  • Cellular localization

    Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus. Note: Shuttles between nucleus and cytoplasm. Detected in nuclear paraspeckles that are found close to splicing speckles.
  • Database links

  • Alternative names

    • Adenomatous polyposis coli membrane recruitment 1 antibody
    • AMER1 antibody
    • APC membrane recruitment protein 1 antibody
    • FAM 123B antibody
    • Family with sequence similarity 123B antibody
    • FLJ39827 antibody
    • OSCS antibody
    • Protein FAM123B antibody
    • RP11 403E24.2 antibody
    • Wilms tumor gene on the X chromosome protein antibody
    • Wilms tumor on the X antibody
    • WTX antibody
    see all

Images

  • CACO-2 cells stained for FAM123B (green) using ab221578 (4 µg/ml) in ICC/IF. 

References

ab221578 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221578.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up