Overview

  • Product name

  • Description

    Rabbit polyclonal to FAM129B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FAM129B aa 237-339.
    Sequence:

    LSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKAR FEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVR NHV


    Database link: Q96TA1

  • Positive control

    • WB: RT4 and U-251 MG sp cell lysates; human liver and tonsil tissue lysates. IHC-P: Human placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 84 kDa.

Target

  • Sequence similarities

    Belongs to the Niban family.
    Contains 1 PH domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA356B19.6 antibody
    • C9orf88 antibody
    • chromosome 9 open reading frame 88 antibody
    • DKFZP434H0820 antibody
    • FAM129B antibody
    • family with sequence similarity 129, member B antibody
    • FLJ13518 antibody
    • FLJ22151 antibody
    • FLJ22298 antibody
    • hypothetical protein LOC64855 antibody
    • Meg 3 antibody
    • Meg-3 antibody
    • Meg3 antibody
    • Niban like protein 1 antibody
    • Niban-like protein 1 antibody
    • NIBL1_HUMAN antibody
    • OC58 antibody
    • OTTHUMP00000022187 antibody
    • OTTHUMP00000022188 antibody
    • Protein FAM129B antibody
    see all

Images

  • All lanes : Anti-FAM129B antibody (ab224116) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG sp (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 84 kDa

  • Paraffin-embedded human placenta tissue stained for FAM129B with ab224116 (1/2500) in immunohistochemical analysis.

References

ab224116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up