Anti-FAM13A antibody (ab122440)
Key features and details
- Rabbit polyclonal to FAM13A
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FAM13A antibody
See all FAM13A primary antibodies -
Description
Rabbit polyclonal to FAM13A -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FAM13A aa 904-973 (C terminal).
Sequence:TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLE HLQEMREEKKRIRKKLRDFE
Database link: O94988 -
Positive control
- IHC-P: Human testis, small intestine, Fallopian tube and cerebral cortex Tissue ICC/IF: Human cell line U-2 OS
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122440 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
|
Notes |
---|
IHC-P
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Tissue specificity
Isoform 1 is widely expressed, with highest expression in skeletal muscle, thymus, brain and lung. Isoform 3 is less abundant than isoform 1 and predominantly expressed in kidney, pancreas,liver, lung and thymus. -
Sequence similarities
Belongs to the FAM13 family.
Contains 1 Rho-GAP domain. - Information by UniProt
-
Database links
- Entrez Gene: 10144 Human
- Omim: 613299 Human
- SwissProt: O94988 Human
- Unigene: 97270 Human
-
Alternative names
- FA13A_HUMAN antibody
- Fam13a antibody
- FAM13A1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
Immunohistochemical analysis of human small intestine labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells.
-
Immunocytochemistry/ Immunofluorescence analysis of U2-OS cells labeling FAM13A with ab122440 showing localization to nucleoli, cytosol & cell junctions.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
Immunohistochemical analysis of human fallopian tube labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
Immunohistochemical analysis of human cerebral cortex labeling FAM13A with ab122440 showing strong cytoplasmic positivity in neurons.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
Immunohistochemical analysis of human testis labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells in seminiferous duct.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab122440 has been referenced in 2 publications.
- Yao MY et al. microRNA-328 in exosomes derived from M2 macrophages exerts a promotive effect on the progression of pulmonary fibrosis via FAM13A in a rat model. Exp Mol Med 51:63 (2019). PubMed: 31164635
- Ziólkowska-Suchanek I et al. FAM13A as a Novel Hypoxia-Induced Gene in Non-Small Cell Lung Cancer. J Cancer 8:3933-3938 (2017). PubMed: 29187867