For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    fam13a-antibody-ab122440.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Regulators
Share by email

Anti-FAM13A antibody (ab122440)

  • Datasheet
  • SDS
Submit a review Submit a question References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
  • Immunocytochemistry/ Immunofluorescence - Anti-FAM13A antibody (ab122440)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)

Key features and details

  • Rabbit polyclonal to FAM13A
  • Suitable for: IHC-P, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-FAM13A antibody
    See all FAM13A primary antibodies
  • Description

    Rabbit polyclonal to FAM13A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FAM13A aa 904-973 (C terminal).
    Sequence:

    TDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLE HLQEMREEKKRIRKKLRDFE


    Database link: O94988
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human testis, small intestine, Fallopian tube and cerebral cortex Tissue ICC/IF: Human cell line U-2 OS
  • General notes

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine)
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • Small G Proteins
    • Regulators

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab122440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF
Use a concentration of 0.25 - 2 µg/ml.
Notes
IHC-P
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF
Use a concentration of 0.25 - 2 µg/ml.

Target

  • Tissue specificity

    Isoform 1 is widely expressed, with highest expression in skeletal muscle, thymus, brain and lung. Isoform 3 is less abundant than isoform 1 and predominantly expressed in kidney, pancreas,liver, lung and thymus.
  • Sequence similarities

    Belongs to the FAM13 family.
    Contains 1 Rho-GAP domain.
  • Target information above from: UniProt accession O94988 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 10144 Human
    • Omim: 613299 Human
    • SwissProt: O94988 Human
    • Unigene: 97270 Human
    • Alternative names

      • FA13A_HUMAN antibody
      • Fam13a antibody
      • FAM13A1 antibody
      • KIAA0914 antibody
      • Protein FAM13A antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)

      Immunohistochemical analysis of human small intestine labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells.

    • Immunocytochemistry/ Immunofluorescence - Anti-FAM13A antibody (ab122440)
      Immunocytochemistry/ Immunofluorescence - Anti-FAM13A antibody (ab122440)

      Immunocytochemistry/ Immunofluorescence analysis of U2-OS cells labeling FAM13A with ab122440 showing localization to nucleoli, cytosol & cell junctions.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)

      Immunohistochemical analysis of human fallopian tube labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)

      Immunohistochemical analysis of human cerebral cortex labeling FAM13A with ab122440 showing strong cytoplasmic positivity in neurons.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab122440)

      Immunohistochemical analysis of human testis labeling FAM13A with ab122440 showing strong cytoplasmic positivity in glandular cells in seminiferous duct.

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (2)

    Publishing research using ab122440? Please let us know so that we can cite the reference in this datasheet.

    ab122440 has been referenced in 2 publications.

    • Yao MY  et al. microRNA-328 in exosomes derived from M2 macrophages exerts a promotive effect on the progression of pulmonary fibrosis via FAM13A in a rat model. Exp Mol Med 51:63 (2019). PubMed: 31164635
    • Ziólkowska-Suchanek I  et al. FAM13A as a Novel Hypoxia-Induced Gene in Non-Small Cell Lung Cancer. J Cancer 8:3933-3938 (2017). PubMed: 29187867

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab122440.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.