Anti-FAM13A antibody (ab204425)
Key features and details
- Rabbit polyclonal to FAM13A
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FAM13A antibody
See all FAM13A primary antibodies -
Description
Rabbit polyclonal to FAM13A -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FAM13A aa 393-464.
Sequence:ESGTLSASSATSARQRRRQSKEQDEVRHGRDKGLINKENTPSGFNHLDDC ILNTQEVEKVHKNTFGCAGERS
Database link: O94988 -
Positive control
- IHC-P: Human cerebral cortex, rectum, pancreas, liver tissue. ICC/IF: A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab204425 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Tissue specificity
Isoform 1 is widely expressed, with highest expression in skeletal muscle, thymus, brain and lung. Isoform 3 is less abundant than isoform 1 and predominantly expressed in kidney, pancreas,liver, lung and thymus. -
Sequence similarities
Belongs to the FAM13 family.
Contains 1 Rho-GAP domain. - Information by UniProt
-
Database links
- Entrez Gene: 10144 Human
- Omim: 613299 Human
- SwissProt: O94988 Human
- Unigene: 97270 Human
-
Alternative names
- FA13A_HUMAN antibody
- Fam13a antibody
- FAM13A1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab204425)
Paraffin embedded human cerebral cortex tissue stained for FAM13A using ab204425 at 1/1000 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling FAM13A with ab204425 at 4 µg/mL (green).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab204425)
Paraffin embedded human rectum tissue stained for FAM13A using ab204425 at 1/1000 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab204425)
Paraffin embedded human pancreas tissue stained for FAM13A using ab204425 at 1/1000 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM13A antibody (ab204425)
Paraffin embedded human liver tissue stained for FAM13A using ab204425 at 1/1000 dilution in immunohistochemical analysis.
Heat mediated antigen retrieval was performed with citrate buffer pH 6 before the IHC staining protocol.
Protocols
Datasheets and documents
References (0)
ab204425 has not yet been referenced specifically in any publications.