Overview

  • Product name

  • Description

    Rabbit polyclonal to FAM175B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human FAM175B aa 226-299.
    Sequence:

    DVEKSERVVESCQAEVNKLRRQITQRKNEKEQERRLQQAVLSRQMPSESL DPAFSPRMPSSGFAAEGRSTLGDA


    Database link: Q15018

  • Positive control

    • Human pancreas tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    FAM175B (ABRO1) is a 415 amino acid protein, sharing 39% identity to ABRA1 in the N terminal two thirds of the protein (amino acids 1 to 260), including a coiled-coil domain and a region called the ABR domain. However, ABRO1 lacks the phosphorylated ser-X-X-phe motif of ABRA1 and, unlike ABRA1, does not bind to BRCA1.
  • Database links

  • Alternative names

    • AA589499 antibody
    • Abraxas brother 1 antibody
    • ABRO 1 antibody
    • ABRO antibody
    • ABRO1 antibody
    • AI853413 antibody
    • C430003P19Rik antibody
    • Em:AC068896.4 antibody
    • Family with sequence similarity 175, member B antibody
    • FLJ22338 antibody
    • hypothetical protein LOC23172 antibody
    • KIAA0157 antibody
    • OTTHUMP00000020697 antibody
    • RGD1308918 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human pancreas tissue labeling FAM175B with ab204511 at 1/50 dilution.

References

ab204511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up