Overview

  • Product name

    Anti-FAM18B antibody - C-terminal
  • Description

    Rabbit polyclonal to FAM18B - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FAM18B aa 173-205 (C terminal).
    Sequence:

    RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS


    Database link: Q9NYZ1

  • Positive control

    • WB: FAM18B overexpression HEK-293T lysate. IHC-P: Human lung tissue. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 23 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Sequence similarities

    Belongs to the TVP23 family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CGI 148 antibody
    • FAM18B1 antibody
    • Family with sequence similarity 18 member B1 antibody
    • Family with sequence similarity 18, member B antibody
    • Golgi apparatus membrane protein TVP23 homolog B antibody
    • Hypothetical protein LOC51030 antibody
    • Hypothetical protein LOC67510 antibody
    • NPD008 antibody
    • Ortholog of human family with sequence similarity 18 member B FAM18B antibody
    • RP23 428I5.3 antibody
    • Trans golgi network vesicle protein 23 homolog B antibody
    • TV23B_HUMAN antibody
    • TVP23B antibody
    • YDR084C antibody
    see all

Images

  • All lanes : Anti-FAM18B antibody - C-terminal (ab224418) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : FAM18B overexpression HEK-293T lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Predicted band size: 23 kDa

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for FAM18B (green) using ab224418 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human lung tissue stained for FAM18B using ab224418 at 1/50 dilution in immunohistochemical analysis.

References

ab224418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up