Overview

  • Product name

    Anti-FAM193B antibody
  • Description

    Rabbit polyclonal to FAM193B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FAM193B aa 482-574.
    Sequence:

    NSTEPKVPNSARAAKRARHKLKKKEKEKAQLAAEALKQANRVSGSREPRP ARERLLEWPDRELDRVNSFLSSRLQEIKNTVKDSIRASFSVCE


    Database link: Q96PV7

  • Positive control

    • IHC-P: Human colon tissue. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab246994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    FAM193B, also known as IRIZIO, was initially identified as a protein that is upregulated in alveolar rhabdomyosarcoma (ARMS), a type of fast-growing tumor characterized by chromosomal translocations fusing the PAX3 or PAX7 gene with that of FOXO1. It has been suggested that, in addition to the PAX3-FOXO1 gene fusion, disruption of the Rb and p53 pathways is required for full ARMS tumorigenesis. In PAX3-FOXO1-expressing primary mouse fibroblasts that possessed a defective p53 pathway, FAM193B expression enabled the tumorigenic transformation, suggesting that FAM193B may contribute to rhabdomyosarcomagenesis in humans.
  • Database links

  • Alternative names

    • Family with sequence similarity 193, member B antibody
    • IRIZIO antibody
    • Protein FAM193B antibody

Images

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for FAM193B  (green) using ab246994 at 4 μg/ml in ICC/IF.

  • Formalin-fixed, paraffin-embedded human colon tissue stained for FAM193B using ab246994 at 1/500 dilution in immunohistochemical analysis.

References

ab246994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up