Overview

  • Product name

    Anti-FAM198B antibody
  • Description

    Rabbit polyclonal to FAM198B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FAM198B aa 32-167.
    Sequence:

    PRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQAAEKGPHRSRDTAEPSF PEIPLDGTLAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRK KHAVASAAPGQEALVGPSLQPQEAAREADAVAPGYA


    Database link: Q6UWH4

  • Positive control

    • IHC-P: Human adrenal gland tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Sequence similarities

    Belongs to the FAM198 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AD021 antibody
    • AD036 antibody
    • C4orf18 antibody
    • DKFZp434L142 antibody
    • Expressed in nerve and epithelium during development antibody
    • F198B_HUMAN antibody
    • fam198b antibody
    • Family with sequence similarity 198, member B antibody
    • FLJ23966 antibody
    • FLJ38155 antibody
    • OTTHUMP00000220346 antibody
    • OTTHUMP00000220347 antibody
    • OTTHUMP00000220349 antibody
    • Protein ENED antibody
    • Protein FAM198B antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FAM198B (green) using ab224234 (4 µg/ml) in ICC/IF.

  • Paraffin-embedded human adrenal gland tissue stained for FAM198B with ab224234  (1/20) in immunohistochemical analysis.

References

ab224234 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up